KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g234384Help
Entry
NEMVE_v1g234384   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g234384
Enzymes [BR:nve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     NEMVE_v1g234384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1052 aa AA seqDB search
MAMLRDTCGENQNRLRPRRESNMADVCRLLYAICNDFNKNTKAPSAVTASTRKDSSFKSM
DSAASGGEIRLKSVELGVEAEESTPLNAAMDNSKGDASNGQWKLFTRVLKSKRFESEKLE
SLYQRYIFRLNQKFTSWLVSILIILSLVLVFFQFFLEQKEQLRWVSYALLALSCGFVLTT
VLCPVGENLQKGLQDDYYSPSDGVWITIFFIYMTYTMLPVRMRIAVFGGCLLLALHLISS
ACVNRNNPNLARLLVGNLLLFICANITGVFTHYPTEISQRQAFLETRRCIEARLTIQKEN
QNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQ
CTAQSLIKTLNELYARFDQLAVENHCLRIKILGDCYYCVSGLPDPRPDHAHSCIEMGLAM
IDAISFVRDATQVNLNMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMESGGLPGRV
HITKEVLDCLNGDYEVEEGHGQERDSYLKQLGIDSKVQDTEDEVNEFLGSSIDARSIERL
RKEYVQPILLTFKNPAKEELYSQERDRMFKSYTSCVFLVYLFILGTQLLVLPRNYVTLAV
FLSIFLIVAITYLLVVSEKFSFLPESLTNLSSTICQSRVICRIIASILIIGLYVAAVGNL
FGCDEPPTPEFTKIFLNNETKLVCNASRYPPQLGVENQSCDYPQYVTFCVTLVMIGCAVF
LQLSTVLKFSLLTVMAIVYILLVQYVAKNSFLRHDFLQFCGLGSGHFIEWSDLSILIVVI
FILALTAHGYLHEQISRLDFLWKLQATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHK
ANKNEDLYYQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQ
FQCIEKIKTIGETYMAASGIKPESQEKLATLNHICTMADFAMAMKRKLEDINLHSFNNFA
MKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKDNHIQVTKAMYEILSTRGYT
FDCRGLVAVKGKGKMVTYWLLGKEGASNSNDL
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttagagatacctgtggtgaaaatcaaaatcgtctcagacctcgaagagaa
agcaatatggcggacgtgtgccggcttctctatgctatctgcaacgactttaacaagaac
acaaaagcaccgtccgctgttactgcttcaactcgcaaggatagcagctttaaaagtatg
gactcagccgcttcaggcggggaaattcgactgaaaagtgtcgaactcggggtcgaagcc
gaagaatcgactccgctaaacgcagcaatggacaattcgaagggagatgcttccaacggg
caatggaaattgtttactcgcgttctgaaatcgaaaagatttgaatcagagaaactcgaa
agcctctatcagcgttacatatttcgcttgaatcagaagttcacaagttggcttgtttct
atccttattatactaagcctggtgcttgttttcttccagtttttcttagagcaaaaagaa
cagcttcgttgggtctcgtatgccctcctagctctctcctgtggttttgtgctaactacg
gtattatgtcctgtgggagaaaatctacaaaagggcctacaagatgattattactctcct
agcgatggcgtctggatcacgatatttttcatatacatgacatatactatgctgccagtt
cgaatgagaatagcagtattcgggggatgcctgcttctcgctcttcacctcatatccagc
gcttgtgtcaaccgcaataatccgaatctagcaagactgcttgttggcaacttgctgtta
tttatttgtgctaatataactggggtgttcacacactacccaacagaaatatcccaaagg
caagccttcctggaaactaggagatgtatagaggctcgtctcaccatacaaaaggagaac
caaaatcaggagcgtctccttctgtccgttctcccgcgctatgttgccatggaaatgaaa
gatgacattgaaagtggaatctcccagaactcccaattccataagatctacattcaaaga
cacgaaaacgtcagtattctattcgcggatattgagggattcactgtgttgtcttcccaa
tgtaccgcgcagtctctcatcaaaacccttaacgagctgtatgcgcggttcgaccagttg
gcggtggagaatcactgccttcgaattaagatccttggcgactgctactactgtgtgtcc
ggtctaccagacccccgtccggaccacgcccacagctgtatcgaaatggggctcgccatg
attgacgccatctcgttcgttcgcgacgccacccaagtaaatctgaacatgagagtcggg
gtgcacatgggcaaagtacacagtggtgtgctaggattggtcaaatggcagtatgacgtg
tggtctgatgacgtgactatagccaatcacatggagtctggcggtctgccagggcgcgtg
cacataaccaaggaggtcctagactgtctgaatggggattacgaggtggaagagggccat
ggccaggaacgagattcctacttgaagcaacttggaatagactctaaagtccaagacacc
gaggacgaggtgaacgagtttctggggagctctatcgatgcacgcagcattgagagatta
cgcaaggaatatgttcagccgatcctactgacttttaagaaccccgccaaagaggagttg
tactcacaagagagggatcgcatgttcaagtcatacacgtcctgcgtttttctcgtctat
ctattcattcttggcacccagttgctagtcttacccaggaattacgtgacgctggcggtg
tttttgtccatctttcttatcgttgccatcacctaccttctggtcgtgtcagagaaattc
tcgtttcttccagagtctctcaccaacctgtcatccaccatctgtcaatcacgcgtcatt
tgccgcatcatcgcgagtatcctgatcatcggcttgtacgtggccgctgtggggaatctg
tttggctgtgacgaaccgcccactcctgaatttacgaagattttcctgaacaacgagaca
aagttggtgtgcaacgccagccgctaccctccccaacttggggtagagaaccagtcatgt
gattatccacagtacgtaacgttctgtgtcacgctagtcatgatcggctgtgcggtgttc
cttcagttgagcacagttcttaagttctcattgctgaccgtcatggctatcgtatacatc
cttctcgtccagtatgtcgcaaagaattccttcctgagacacgactttttgcagttctgt
ggacttggaagtggtcactttatcgaatggagtgatctatcaattctgatcgtcgttatc
tttatcttagcgcttaccgcgcacggctacttgcatgagcaaatttctcggttggatttc
ctgtggaaacttcaggcaacagaggagaaaaaagagatggagcagcttagagaatacaac
aagaaattgctttacaacattcttcctgtgcacgtggctcaacacttccttggccacaaa
gccaacaaaaacgaggatttgtattatcaatcttgtgataaagttgccgtaatgttctcc
aacatctgtaatttctcggatttctacactgagctagacgctaatggcgaaggtgtggag
tgcttaagattactcaacgagattttagccgactttgacgagcttctgtcagagccccag
ttccaatgtattgagaagatcaagacaattggcgagacgtacatggctgcatcaggaata
aaaccagaatcacaggaaaaacttgcaactttgaaccatatctgcacaatggctgacttc
gcaatggcaatgaaacgaaaactagaggatattaacctccattctttcaacaactttgct
atgaaaatcggtttgaactttggtcctgtggtcgctggggtaattggggcacacaaacct
cagtatgacatctggggagacacagtgaatgtcgcaagcagaatgtatagcacaggaaaa
gataatcacatacaggttacaaaggccatgtatgagatcttgtcgactcgcggatacacc
ttcgactgtcgaggccttgttgctgtgaaaggcaaaggaaagatggttacctactggctt
ctgggcaaggaaggtgctagcaactccaacgatctttag

DBGET integrated database retrieval system