KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g234541Help
Entry
NEMVE_v1g234541   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NEMVE_v1g234541
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g234541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 386 aa AA seqDB search
MGANTSQLEKEIGHEFPPNEHFFGLVNFGNTCYCNSVLQALFFCRPFRDKVLSYKPPSKR
KETLLTCLADLFNNIASQKKKVGVIAPKKFVARLRKENELFDNYMQQDAHEFLNYLLNTI
ADLLQGEKVKEKEKEKHSSSGSISSKGSLSSASTIGSITPAIPNGTANCIINNPTTTNSN
MRTETTWVHEMFEGTLTNETRCLCCESVSSKDESFLDLSVDVEQNTSITHCLRGFSSTET
LCSEYKYFCETCCTKQEAQKRMRVKKLPKLLALHLKRFKYMEQLQRYTKLSYRVVFPFEL
RLFNTSDDAVNNDQLYDLVSVVIHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIEPHTI
EDFYGLTSDIHKSSESGYILFYEARV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaacacttctcaactcgagaaagaaattggtcatgaatttcctccgaatgaa
catttctttgggcttgtaaactttggaaatacttgttattgcaactcggtgctgcaagct
ttgtttttctgccggccttttcgcgacaaggtcctgtcatacaagccaccttcgaagagg
aaagagaccttactcacatgtttagcagatttgttcaacaacatcgcttcgcagaagaaa
aaagtgggtgtcatcgcacctaagaaatttgttgcaagacttagaaaagagaacgaatta
tttgataactacatgcaacaggatgctcatgaattcttgaattatctactcaacacgata
gctgatcttctgcaaggtgaaaaagtgaaagaaaaggaaaaggaaaagcacagcagtagc
gggagcattagcagcaagggcagcctaagctctgccagtaccatagggtctatcactccc
gcaatacctaacggcactgccaactgcatcatcaataatccaaccaccactaacagcaat
atgcgtacagaaaccacatgggtgcacgagatgtttgagggaacgctgacaaacgagaca
aggtgtctctgctgtgaatcagtaagcagcaaagatgagtcattccttgacttgtcggtg
gatgtggagcaaaatacttctattacccattgtttaagggggttctcttccacagagaca
ttgtgtagtgaatataagtatttttgtgaaacctgctgtacaaagcaagaggcacaaaaa
cgaatgcgagtaaagaaacttcctaagctccttgccctccacttgaagagattcaaatac
atggagcagcttcagagatacaccaagctgtcatatcgtgttgtgttcccatttgagctt
aggttattcaatacgtctgacgatgctgttaacaatgatcagttgtacgacctagtgtct
gttgttattcattgtgggagtggtcctaaccgaggtcattacatcacaatagtcaagagt
catggattctggctgctttttgacgatgacattgtagagaaaattgagccacatacaata
gaagacttctatggccttacttccgatatccacaagtcctcagaatctgggtatatcttg
ttctacgaggcgcgcgtctga

DBGET integrated database retrieval system