KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g236749Help
Entry
NEMVE_v1g236749   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:nve03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:nve04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MNKFDALKLDDSNNDDSADDNDKEDEEGDYSKKNGMKDFDADSAEEEEWKKYQNELLAKE
CKPLEGEHPLQCPYVFWFSRRPPGKIQSATNYADNIKIVGKFASVEQFWGFYSFMVRPGE
LTGHSDIHLFKDGIKPMWEDEANKCGGKWIVRLRKGLASRCWENLVLAMLGEQFMVGSEV
CGAVISVRFQEDIISIWNRNAADQATTTRIRDTLKRVLNLPPNTIMEYKAHQDSIKDNSS
FRNTDVFLR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgacgcgttaaaactggatgattctaataacgatgacagtgcagatgat
aacgataaggaggacgaagaaggggattatagcaagaaaaatggaatgaaggattttgat
gccgacagtgcagaggaagaggaatggaaaaaatatcaaaatgagctactagccaaagaa
tgtaaaccattggaaggggaacatccgttgcagtgtccatatgtattctggttttcacga
agacctcctgggaaaatccagtcggctacaaactatgcggacaacatcaaaattgttgga
aaatttgcatctgtggaacagttttggggattttatagctttatggtcagaccaggggag
ctcacaggtcacagtgatattcatctgtttaaagatggcattaaaccaatgtgggaggat
gaggcaaacaaatgtgggggcaagtggatagtcaggctaagaaaaggacttgcatcaaga
tgctgggaaaacctggtgctcgcaatgctaggagaacagttcatggtagggtcagaagtc
tgtggggcagtcatttccgtcaggtttcaggaagacataatatccatatggaatcgtaat
gctgctgaccaggccacaacaacaaggattagggacacactgaaaagagtgctgaatctt
cccccaaacacgatcatggagtacaaggctcaccaggacagcatcaaagataactccagt
ttcagaaatacagatgttttcctgagataa

DBGET integrated database retrieval system