KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g236749Help
Entry
NEMVE_v1g236749   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g236749
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    NEMVE_v1g236749
Messenger RNA biogenesis [BR:nve03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     NEMVE_v1g236749
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NEMVE_v1g236749
Translation factors [BR:nve03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NEMVE_v1g236749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MNKFDALKLDDSNNDDSADDNDKEDEEGDYSKKNGMKDFDADSAEEEEWKKYQNELLAKE
CKPLEGEHPLQCPYVFWFSRRPPGKIQSATNYADNIKIVGKFASVEQFWGFYSFMVRPGE
LTGHSDIHLFKDGIKPMWEDEANKCGGKWIVRLRKGLASRCWENLVLAMLGEQFMVGSEV
CGAVISVRFQEDIISIWNRNAADQATTTRIRDTLKRVLNLPPNTIMEYKAHQDSIKDNSS
FRNTDVFLR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgacgcgttaaaactggatgattctaataacgatgacagtgcagatgat
aacgataaggaggacgaagaaggggattatagcaagaaaaatggaatgaaggattttgat
gccgacagtgcagaggaagaggaatggaaaaaatatcaaaatgagctactagccaaagaa
tgtaaaccattggaaggggaacatccgttgcagtgtccatatgtattctggttttcacga
agacctcctgggaaaatccagtcggctacaaactatgcggacaacatcaaaattgttgga
aaatttgcatctgtggaacagttttggggattttatagctttatggtcagaccaggggag
ctcacaggtcacagtgatattcatctgtttaaagatggcattaaaccaatgtgggaggat
gaggcaaacaaatgtgggggcaagtggatagtcaggctaagaaaaggacttgcatcaaga
tgctgggaaaacctggtgctcgcaatgctaggagaacagttcatggtagggtcagaagtc
tgtggggcagtcatttccgtcaggtttcaggaagacataatatccatatggaatcgtaat
gctgctgaccaggccacaacaacaaggattagggacacactgaaaagagtgctgaatctt
cccccaaacacgatcatggagtacaaggctcaccaggacagcatcaaagataactccagt
ttcagaaatacagatgttttcctgagataa

DBGET integrated database retrieval system