KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g236749Help
Entry
NEMVE_v1g236749   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve03013  RNA transport
nve04150  mTOR signaling pathway
Module
nve_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g236749
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    NEMVE_v1g236749
Messenger RNA biogenesis [BR:nve03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     NEMVE_v1g236749
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NEMVE_v1g236749
Translation factors [BR:nve03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NEMVE_v1g236749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 5515405
NCBI-ProteinID: XP_001635523
JGI: 236749
UniProt: A7RYG8
AA seq 249 aa AA seqDB search
MNKFDALKLDDSNNDDSADDNDKEDEEGDYSKKNGMKDFDADSAEEEEWKKYQNELLAKE
CKPLEGEHPLQCPYVFWFSRRPPGKIQSATNYADNIKIVGKFASVEQFWGFYSFMVRPGE
LTGHSDIHLFKDGIKPMWEDEANKCGGKWIVRLRKGLASRCWENLVLAMLGEQFMVGSEV
CGAVISVRFQEDIISIWNRNAADQATTTRIRDTLKRVLNLPPNTIMEYKAHQDSIKDNSS
FRNTDVFLR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgacgcgttaaaactggatgattctaataacgatgacagtgcagatgat
aacgataaggaggacgaagaaggggattatagcaagaaaaatggaatgaaggattttgat
gccgacagtgcagaggaagaggaatggaaaaaatatcaaaatgagctactagccaaagaa
tgtaaaccattggaaggggaacatccgttgcagtgtccatatgtattctggttttcacga
agacctcctgggaaaatccagtcggctacaaactatgcggacaacatcaaaattgttgga
aaatttgcatctgtggaacagttttggggattttatagctttatggtcagaccaggggag
ctcacaggtcacagtgatattcatctgtttaaagatggcattaaaccaatgtgggaggat
gaggcaaacaaatgtgggggcaagtggatagtcaggctaagaaaaggacttgcatcaaga
tgctgggaaaacctggtgctcgcaatgctaggagaacagttcatggtagggtcagaagtc
tgtggggcagtcatttccgtcaggtttcaggaagacataatatccatatggaatcgtaat
gctgctgaccaggccacaacaacaaggattagggacacactgaaaagagtgctgaatctt
cccccaaacacgatcatggagtacaaggctcaccaggacagcatcaaagataactccagt
ttcagaaatacagatgttttcctgagataa

DBGET integrated database retrieval system