KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g238058Help
Entry
NEMVE_v1g238058   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1034 aa AA seqDB search
MAGGLTQVTLEVQGKVKWTDPGRACIPLKHGSLHLLRQGLSDTFFVQIKQTKPTKCSSKI
KLIKHGFRFPNRNQRLALTFSNSANTLVLEEADELQLQKLITALGDIFEGSIPKDLSTTR
HLAESSETRTSTKRKYEDIENQPLNSARKSSTGHHSEANQHLVDSSPRHAQRLSSMLKTP
RLKRPVADISPESYRKSLSAKTPLSERRPSPDNLPVSSSQSPSLFSFYGSNNSSAVSGSK
IRSHTKVTPKGRLRYGLSRDFSFHKRAQVTIQDKTQLTGFSNLGNTCYMNAILQSLLGIE
PFAQDLANKELHNLVSNSQCLLKSAYGLLCCKRNKCELDVQRMHLRKFKRQISEAATRFS
GNLQHDAHEFLCQVLDQLKDDVLKPLTESPSDGKVYKDVPAEDQPSPVQVNVLCPVTRNF
ECCVLHTITCKRLDDGYEVSPNMSGLPVDRLIKSYFRTENVEYTCEECKHKQATISHKFS
RLPRVLILHLKRYNFDKVTDQQEKKQNNINLQKFIDVGNLCSSKTSPPLQFTDKSVILSP
PKAKFKAFKHPLDDDSFDVSNPSPSARRKLHIEFNTPKKSHGSASKPNSNKQKLDRLTPL
SIASDKGDYNSSMNLLEMCEEDQMQWAMNESRNQSTEIVPKDFGDEMDCTDEELLSGLEE
IEKDINLKPADKNGCDESRDKEYGLLGGAPTRSVTISDSGDESGLESAVRTSKFSYDCSS
DLALGSDNGGSPRSSLRNDDISPCSIMDHTPTLKKFTGDLIIGVNDCHGNKRTHPNSVGL
DTSCTFNTKYRPNHCSEKNPGRSVSPRRCSDKADSSIQGRNNFSDDKPGRRPVLKPCHIR
TPDPVEEAERSDTECFEENLAKAISKSLQDQKMSKTEEEQLQQVLELSLQVILILINFGS
IEAKRQKRDDLQSPDVPEPENEPLHNSTDSGLQVCMTSYGAKQFTDSEFQDNPEDNGEVL
THSYRLVSVVSHLGNMSSVGHYISDVYDCKCDEWTSYDDCTASKVDEHKVRYGRSKVAYV
LFYLYKQCVDQVKR
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggtttgacgcaggtcactttggaagtacaggggaaagttaagtggacagac
ccaggccgggcttgtattccactcaaacatggatccttacatctactgaggcaaggactc
tcagatacttttttcgttcaaatcaagcaaactaaaccaacaaaatgctcttcgaagatc
aagcttataaagcatggattcaggtttccaaacagaaatcaaaggctggcattgaccttt
tccaacagcgcaaacactctcgtgttagaagaggctgatgaacttcagctgcagaaacta
atcactgctttaggtgatatcttcgagggttctattcctaaagatctatctacaactaga
catttagctgagtcatcagaaacaagaacttccacaaaacgaaaatatgaagacattgag
aatcagcccttgaatagtgcaagaaagtcatccactggccatcacagtgaagcaaatcag
cacttggtggattcatcacctagacacgcacagcggctctcttccatgctgaagacacca
agattgaaaagacctgtggcagatatctcaccagaatcatatcgtaaatcattgtcagcc
aagactccactttcagaaaggagaccttccccagacaatcttcctgtatcgagcagccag
agcccttctttattttccttttatggttcaaataacagttcagctgtctcaggctccaaa
ataagatctcataccaaggtcactccaaagggcaggctgcgatatggtctctccagagac
ttttcctttcacaaaagagctcaagtcactattcaagacaagacccagctgactgggttt
tctaatcttggcaatacatgttatatgaatgccatacttcaatctctgcttgggatagaa
ccttttgcacaagatctggctaacaaggagttacacaatcttgtgtcaaattcacagtgt
cttctcaagtcagcctatgggttactctgttgcaaaaggaacaaatgtgagctggatgtt
caaaggatgcatttgagaaaatttaagcggcaaatatccgaggctgccacaaggttttca
ggaaatttgcaacatgatgctcatgagttcctttgccaagttctggatcagctgaaagat
gatgtgctaaagccgctgacagaaagccccagtgatggcaaggtttacaaagatgttcct
gcagaggatcagcccagtccagtgcaagtaaatgttctttgcccagtaacaagaaacttt
gagtgctgtgtgctacacactatcacttgtaagaggttagatgatggttatgaagtgtca
cctaacatgagtggcctccctgtagatcgtcttatcaagtcatatttcaggacagagaat
gttgaatatacatgtgaagagtgtaaacacaaacaggccactatctcccacaagttcagt
agactgccgagggtactgattttgcatctgaagagatacaacttcgataaagtcacggat
caacaggagaaaaaacagaataacatcaacttacagaagtttatcgatgtgggtaatcta
tgctccagtaagacatcgcctcctttacagttcacagacaagtcagtaatcctgagcccc
cctaaagcaaagttcaaagccttcaagcacccattagatgatgactcttttgatgtctca
aatccatctccatcggctagaagaaagctccacatcgagttcaatacgcccaagaaaagt
cacggaagtgccagcaaacccaactccaataaacaaaaactggacagattaacacctctt
tctatagcaagtgataaaggcgactataacagcagtatgaatctgctggaaatgtgtgag
gaagaccagatgcagtgggccatgaatgaaagccgtaaccaaagcacagagatagtgcca
aaagactttggtgatgaaatggactgtactgacgaagaactgctaagcggcttggaagag
attgagaaagacatcaatctgaaacctgctgataaaaatgggtgtgatgagtctagagat
aaagagtatggactattgggtggagctcctactcgttccgtgaccatctctgacagtggt
gatgagagtggacttgagtccgctgtaaggacatctaagttttcctatgattgtagctct
gacttagccttaggttcggataatggtggctcgcccaggtcatcactgaggaatgatgac
attagtccatgttctatcatggaccataccccaacgctgaaaaagttcactggtgatttg
attattggtgtaaatgattgccatgggaacaaaagaacacatccgaacagtgttggccta
gacactagttgcacttttaatactaaatatagaccaaaccactgttcagaaaagaaccca
ggaagaagtgtgagtcctagacgttgttcagataaggctgacagctcaatacaagggagg
aataacttctcagacgataaaccaggaaggagacctgtgctcaagccctgccatatccgc
acccccgacccggtagaggaggcagagaggtctgacactgagtgctttgaggagaatctt
gcaaaggctatatcgaaaagtttacaagatcagaaaatgtcaaaaaccgaagaggaacag
cttcaacaagtgctcgaactcagtcttcaggttattttgattcttataaatttcgggtct
atagaagctaaacgacagaagagagacgacttgcaatcgcctgatgttccagaacccgag
aatgaacctcttcacaactctactgattcgggactccaggtatgtatgacgtcatatggg
gctaaacaattcactgactcggaattccaggataatcctgaggataatggcgaagtcttg
acgcactcatatcggttggttagcgtggttagtcaccttggcaacatgtcttctgttggg
cattacatcagtgacgtctacgactgtaagtgcgacgagtggacgagttacgacgactgc
acggccagcaaggtggacgaacacaaggtgcgctatggacgatccaaagtcgcgtacgtg
ctattctatctctacaagcaatgcgtcgaccaagtcaaacgttaa

DBGET integrated database retrieval system