KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g239368Help
Entry
NEMVE_v1g239368   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nve04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 363 aa AA seqDB search
MASGTVLFKLFLLFSISSLTQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPT
YEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDIND
FIKFIEEKTGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVY
EKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSF
VDFMNEKCGTKRTPGGGLNEQAGRINAFDGFAVEFMKNKDGRDNVYNNAKSAVDKQDDQK
MATYYVKVMERVQSKGDSFIQTETSRLERLLEGQISAGKKDQFIMRKNVLSQFAKGMESK
EEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggcactgttctcttcaaactcttccttcttttctcgatttcctcgttaacc
caaggaaaagtgattgatctcaccaaggataattttgatgaggtagttaatggagaaaag
tttgctcttgttgaattctatgccccatggtgtggtcactgcaagcagctcgcccctacc
tatgaacagcttggtgaagcctatacccagtcaagtgacgtcataattgccaaggtggat
gctgatggggatcgggacttagggtcaagatttgatgttaaaggatttcctaccatcaag
tattttcctaaaggaagcaccactccagaagaatacaatggtgggcgtgacatcaatgac
tttataaaatttattgaagaaaaaactggtgttcgaggcagagtgcctgtcatcccatca
gctgtcgcagatcttgatgaatccaattttgataagattgtcaagaaccctgataacaat
gttctggtggagttctttgcaccttggtgtggtcactgtaaaaatcttgctccagtttat
gaaaaagttggtgaagctttcaaaaatgaaccaaattgtgttattgccaaagttgatgcc
gatgctcactccgccctgggccaaaagtatggagtaagtgggtaccccaccctcaagttc
ttttccaaaaccaacaaggacggagaagagtattctagtggacgtgatgaacaatcattt
gtggacttcatgaatgagaaatgtggaaccaaacggacacctggcggaggactgaatgaa
caggctggaagaatcaatgcttttgatggatttgcagtagagttcatgaagaacaaggat
ggtcgtgataatgtttataacaatgctaaatctgctgtggataaacaagacgaccaaaag
atggctacctattacgtgaaagtcatggagcgagtgcagtccaagggagactcgttcatc
cagacagagaccagccgacttgaacgtcttcttgaggggcaaatcagtgcaggcaagaaa
gaccagttcattatgcgtaagaacgtgctatcgcagttcgctaaaggaatggaaagcaag
gaagagctataa

DBGET integrated database retrieval system