KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g239614Help
Entry
NEMVE_v1g239614   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g239614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 3367 aa AA seqDB search
MEARTFYLSEDADDVFLQSAFVEKPLQSVPHGQQALRRESDPHTQERPGQSSQQAVGRAI
DSYATPAEQRFPQGTHEQNGGLRNGVNTATARKEYDFYASQDLDPLPPPPPPLLDESGSS
PFDDRSRDDDRWRSRAADNAQWSRGADDRHWSRGDEDRHWSRGDDDRQWSRGADDRLWSR
GDEDRQWPRYYNSHALTHDGRYLNTEQTNPLPRRSKSLTSFNDDGDYGLAAFPIANRTQD
DSVRSSNGSGRSSVQANGVLARSKSERAIESEDVVCKVGTPVLRSQSWKDIRDEWSEEGN
QVAKGGKKINNGLAKNYKRFINQGSNSQTKVRTMASEPSNYRKSADFDFNMPDTDPTAAD
AEWKKIQQNTFTRWCNEHLKCVKQFVYSLETDLCDGLKLIALLQVLSQKRLPRFNKKPVF
KSQKIENVSISLKFIEDENIRLVNIDASDIVKGNLKLILGLIWTLILKYQISMPYLDDDD
DENHKMTPKQALLAWVKSKMPESVPMDNFTTHWNDGRAIACLVDAVAPGLLPECEDLDPK
DALQNAQQAMKLAQDWLDIPQVLDPADMVNPKVDELSMMTYVSYFPEAKLKPGAPLRPRV
HPASRCHAKGPGIEPKGNVAKRPADFTVFAQGAGLGKLGVQVYGPGKTEQEVVVKDNEDH
TYSCRYVPNTPGKRYVSNTPDKRYLSNTPGKRYVSNTPGKRYVSNTPGKRYVSNTPGKRY
VSNTPGKRYVSNTPDKRYLSNTPDNRYLSNTPGKIYVSNTPGKRYVPNTPGKRYVSNTQG
KYDVHVKWNGRHIPKSPFRVEVSSDLDAGKAYAKGPGLAPTGVVAGKYTDFTVFTAGAGE
GKVSVKVIDPRGGEDVDVIIEPQDNQEFLVEYQPVNTGKHTIKVGYGGQPIHGSPFHVMV
SPPKVDPIPSKVKVFGAGVEPTGLKAGMRAPFTVDTRGAGDGELDVFVEGPLGEEKVDIK
NNNDGTYSCIYFPSKFGKYVVSVTWSGEQAAKSPYEVKVATAVDASRIKAYGPGLERGIA
NKPCHFTVETKGAGVDSLGFAIEGPAQAEIKCVDVGDGKCEVTYYPLVPGKYAVHVTCGD
VDIKNSPFMVPISPAGDASKVYAKGPGLEPEGVCAGCPAEFTVYTNEAGDGDVDIKVMDS
QGKKSPSEIKDNKDGTYTVTYYPDKPGMHTVAVHFNDKPIPKSPFKVNICSTNTSKCRAY
GPGLEKGFVDQRNDFKIETKGAGEGGLGLTIEGPSEAKIDCIDNGDGSCDVHYWPNEPGD
YMVNILYADKHIPGSPFKARISHPFDPSKVKVEGPGIEPGICVGDPADIDIDTRLAGDNL
LEVKVVDDLNQPVKCDIEEEEYGMYACTYTPEKDVPHRVNVTYGSKHVPGSPFKVPIKPA
GDSSKVKVAGPGVAPTGVNPGKPTWFTIDCKDAGKGDVHVTVEPAAKGGKPVEKITVAEV
SKDNYKCDYIAPAEGPYNVKVSFGDKPAPGSPFRVNVAKAGNAGKCKAQGDGLETAIINQ
LAEFDVDCSQAGEGQLMASVTNPSGAHTDTLITDNQDGSFGVSYTPFEEGIHDLAVKFGD
DHIPGSPFKVDVLPVTDPSKCKAYGPGLQHAQLNKPADFTVETKGAGAGGLSLAIEGPSE
AKLTCQDNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPFTAKAGRPVDPSKVKCHGPG
VDRVNPLFSKTPQRFTVDTTEAGVAPLDVSVETPNRQTIKPDSVVEEKPGIHAVTYTPED
EGRYKVNVKYASTHVPNSPFNVRAGPPFDASKVKVSGPGVDETPYTCEPVEFLCDCSEAG
TAPLGVTVSPPSGPDLKPDVKDNGDGTYTVAYVPDKPGRYNIDVKYGDRRVPRSPFRPTV
KPSGDASKVKVKGLGPNEKVMTNQENDFLVDARNAGKGTPVCTCIGPNKKDVPVDVVPNK
DGTYSCYYTPEDEGRHSVDVKFAGDNVPGSPFLVKAEKGLDFDKIKCAPRNPVDEPPVNK
ELVYAVDAAAAEPVPGQGLVNGSLLTPSGKKEPVKVRNNKDGTYDVACVPKTPGPHELTV
KYDDQPIPGSPFKFNAVEGGPGAVKAFGKGLERGLAKEPCEFTVVTRDAGPGGLSLAVEG
PSKAEIKCQDNGDGSCNVTYVPDEPGEYNINVKFADKHIPGSPFLAQIYNTWDDLDAAKP
RPTVGKPCDVGLDIPDLPPDVSVLKGTLKRPSSNKEEPIEIRINDDDSLGITFVPYEPGE
HLISIKKNGRHVQNSPFSVMVQAQRIGDVYPVGHTADVGIPGLEDFGDLRKLTATLRRPH
SNAEESVHLHKNPDNSISCSFLPREPGEHFLTVKKDKQPIPGSPFSILVEAEEPIEAVGC
PVDYCFDIKDDVNLPDELDKLKATITRPNTDKEEPVGLKLNSDLSLSCSFIPRETGMHLI
HIRKNGRDITGSPFPLNVTAPEAVSQVGRPYGLGLDFDGVNPCDDYAHLTATLKRPSSNK
EEKLNLLLNGDNTLGVAFTPREVGEHLVHVRKDGCELPESPISIMVVGKDEKVEEVHPVK
KTCDLSLDIPGVTLPDDFKKLSGSLKRPTSDKEEPLTLTLNKKDNTLGVSFVPVEPGEHK
IRIKKEGKDVPGSPYSVMVEAAEAVNAVGKPCDCCLPGRFDEDDLRRLNATLKRPSSRTE
EPLKLKLNSDKTLSAVFIPNETGEHIINVKKFGRHIDGSPFSVMVVAPEANAIGRPCGVG
LEIPGLRLPEDFDLLTGSLRRPSKTCEDSLNLTLNSDNTLSVSFVPQETGEHFVSVKKSG
KHVTGSPFSVMVSGPGPADASKVKVTGDGLRKGVTGEPARFTVNTRDAGYGGLGLSIEGP
SKAEINCVDNEDGTCSVDYLPTEPGKYTINIKFADEHVPGSPFKANIRRPGEEEIVAMSE
DGVESEPTQRVSQVFEDLVSFGAAAPQPHDFVFDLKGYNVEDLETTVISPDGEVLPAEIV
ESGTNSYTIRFMPKESGEHVINVKYRGRHISGSPFKVYVEAPVWGGAAKCTAAGPGLERG
VVGHPGDFTVWTRDAGPGGLAIAVEGPAKAEITCHDNGDGSCNISYLPTAPGEYTIHIRF
ADEDIPGSPFKVFVTTEVEDRFRDLKLSDLESSGLKVGQPASFSVQTNAPVGKVSATVIA
PSGTESKAVISDLGKGNYAIRFVPKEFGDHLVNVKFDETHIPGSPFKIRVGGGGAHPEKV
KAYGPGLSSGHAGKSAEFTVNALEAGSGALALSVDGPAKVKMNCTENQDGTYQVTYYPVV
AGEYTISIKFAGQHIPDSPYNVTIFPPSGHLQHSEGDASKCTSRGTGLHRAVLGQPNSFT
VNASNAGRGSLMVGVEGPAIPAKEINVKHTGSNVYAVNYALEEPGTYILKVLWGEKHIPG
SPFHVTV
NT seq 10104 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcggacgttttacttgagtgaagatgcagatgatgtgttcctacaatctgca
ttcgttgaaaagcccctgcagtccgtacctcacggccagcaagccttaaggagagaaagc
gacccacacacacaagaaaggcccgggcagtcatcacagcaagccgtggggagagcaatc
gactcttacgcgaccccggctgagcagagattcccacaaggaacacatgagcaaaacggg
gggctaagaaacggcgtaaacaccgcgaccgcgagaaaagaatatgatttctacgcgagt
caggaccttgatcccctgccaccgccgccgccgccattactggacgagagcgggtcctcc
ccctttgatgacaggtcacgtgacgacgacaggtggaggtcacgtgctgctgataatgcg
cagtggtcacgtggtgctgatgacagacattggtcacgtggtgacgaggacagacattgg
tcacgtggtgacgatgacagacagtggtcacgtggtgctgacgacagactctggtcacgt
ggtgacgaggacagacagtggccacgttattacaatagccacgcccttactcacgatggc
cgctacttgaacaccgagcaaacgaacccactgccaaggagatccaaaagccttacatcc
ttcaatgacgacggcgattacggcctcgcagcctttccgattgcgaaccgaacgcaggac
gacagcgttcgaagttccaacggaagcggcaggagcagtgtacaagcgaacggggtattg
gctcgtagtaaatctgagcgtgctattgaaagtgaagatgtggtttgtaaggttggcacc
ccggtacttcgctcgcaaagctggaaggatataagagacgagtggagtgaggaggggaat
caagtcgccaagggcggcaagaagataaacaatgggctcgccaagaattacaagaggttc
atcaaccagggatcaaacagccaaacgaaggtccgtacgatggcttccgagcccagcaat
taccgtaaatctgcggactttgactttaatatgccggacactgatccgacggccgcggac
gccgagtggaagaagatccaacagaacacattcactcgatggtgcaacgagcatctgaaa
tgtgtgaaacaatttgtgtatagccttgagaccgatctatgtgacggcctcaaacttatt
gcacttctccaagtcctctcgcaaaagcggcttccccggttcaataagaaaccagtcttc
aaatcccagaagattgagaatgtttccatttcgctcaaatttatcgaggacgagaacatt
cgactcgtgaacatagatgctagtgatattgtgaaggggaacctgaagcttattcttggt
ctgatatggacacttatcctgaagtaccagatcagcatgccctacctggatgatgacgat
gacgaaaaccataagatgacgcccaagcaggcactgctggcgtgggtcaagagcaagatg
ccagagagtgttccaatggacaactttaccacccactggaacgatggtcgcgccattgcc
tgtctggttgacgctgttgcacctggcttactgcctgagtgtgaggaccttgatcctaag
gatgcactgcagaatgcacaacaagcaatgaagcttgcacaagactggctggatattcca
caggtcttagatccagctgacatggtgaaccccaaggttgatgagcttagtatgatgacc
tacgtctcctacttcccagaagcaaaattgaagcctggagcacccctccgccccagggtc
catcctgcctccagatgccatgccaagggtcctggtattgaaccaaagggcaatgtggcc
aagagaccagctgacttcactgtgttcgcacaaggtgccggcctgggtaaacttggtgtg
caagtctatggacctggaaagacagagcaagaagttgttgttaaggacaatgaggaccac
acttactcctgcagatatgtgcctaacacaccaggtaagagatatgtgtctaatacacca
gataagagatatttgtctaatacaccaggtaagagatatgtgtctaatacaccaggtaag
agatatgtgtctaacacaccaggtaagagatatgtgtctaatacaccaggtaaaagatat
gtgtctaatacaccaggtaagagatatgtgtctaatacaccagataagagatatttgtct
aatacaccagataatagatatttgtctaacacaccaggtaagatatatgtgtctaataca
ccaggtaagagatatgtgcctaacacaccaggtaagagatatgtgtctaatacacaaggc
aaatatgacgtccatgtgaaatggaatggcagacacattcccaagagtcctttccgtgtt
gaagtgtcttctgatcttgatgccggcaaagcctatgccaaagggcctggcctggcaccc
acaggcgtagtggctggaaaatacaccgacttcactgtctttacagcaggagctggagaa
ggcaaggtttctgtgaaggtgattgatccacgtggtggagaagatgttgatgtgatcatt
gagccacaagacaaccaggaattccttgttgaataccagccagtcaacactggaaagcat
accatcaaggttggatatggtgggcagccaatccacggcagcccattccatgtcatggtc
agcccacccaaggtcgatcctatcccaagcaaggtcaaggtctttggagcaggtgttgag
cctactggcctgaaggctggcatgcgtgcccccttcactgtcgacacacgaggagctgga
gatggtgaattggatgtttttgttgagggccctcttggggaggagaaggttgacatcaag
aacaacaatgatggcacttactcttgcatctatttcccgtcaaagtttggcaaatatgtg
gtatccgtaacctggagtggtgaacaagcagccaagagcccgtatgaagtgaaagttgct
accgctgtcgatgccagtaggatcaaggcatatggaccaggtcttgagcgaggcattgca
aacaagccttgccacttcactgtagagaccaagggagcaggtgtagacagtcttggcttt
gcaatcgaaggcccagcccaagcagagattaagtgtgttgatgttggtgacggcaagtgt
gaggttacctactaccctcttgttcctggaaagtatgctgtgcatgtgacttgtggtgat
gttgacatcaagaacagcccctttatggtccccatttcacctgctggtgatgcctccaag
gtttacgctaaggggccaggcctggagccagagggtgtctgtgctggttgccctgcagaa
tttacagtgtacactaatgaggctggtgatggcgatgttgatatcaaagtgatggatagc
cagggcaaaaaatccccttcagagatcaaagacaacaaagatggtacctacactgtcact
tactaccctgataaacctggtatgcacacagttgctgtccacttcaatgacaagcctatc
cccaagagcccattcaaggtcaatatttgctccaccaatacctccaagtgtcgtgcttat
ggccctggcctagagaagggctttgttgaccagaggaatgacttcaagattgaaacaaag
ggtgccggagagggaggacttggcttgaccattgaggggccatcagaagctaagattgat
tgtattgataatggagatgggtcatgtgatgttcattactggccaaatgagcctggagat
tacatggtgaacatcctgtatgctgacaaacacattcctggaagtcctttcaaagcaagg
atcagccatccatttgatccctccaaggtcaaggttgagggtcctggaatagagcctgga
atttgtgtaggtgatccggcagatattgacatagacaccaggctagcaggagataatctt
cttgaggtcaaggttgttgatgatctgaaccaacctgtgaagtgtgatattgaggaggag
gaatatggcatgtacgcttgtacctacacacccgagaaagatgtaccccacagagttaat
gtcacctacgggtccaagcacgtccctggcagcccttttaaagttcccatcaagcccgcc
ggtgattcatctaaagtcaaggtcgcgggaccaggtgttgcacctactggtgtaaatcct
ggaaaaccaacatggttcactatagactgcaaggatgccggcaagggagatgtccatgtc
accgtcgagcccgcagctaaaggaggcaaacccgtggagaaaatcaccgttgccgaagtc
tccaaagataactacaaatgcgactatattgcacccgccgaaggtccatacaacgtcaag
gtgtctttcggcgacaagccagcgcccggtagccccttcagggtgaatgtggcgaaagca
ggcaacgccgggaagtgcaaagcccaaggagatgggctcgagaccgccattatcaatcag
ctcgccgagttcgatgtggactgctcacaagcaggcgaaggtcaactaatggcatctgtg
accaacccttccggtgctcacacagacacattgataactgacaaccaagatggatccttt
ggcgtctcctacactccattcgaagagggcattcacgatctcgccgtcaagttcggagat
gaccacatacccggaagccccttcaaggtcgatgtacttccggtcaccgatccatccaag
tgcaaggcttatggaccaggcctccagcatgcccaactgaacaaacccgccgactttacc
gtcgaaaccaaaggtgcgggtgctggagggctgagcctcgctatcgagggcccgtccgaa
gccaaacttacatgccaagacaacggagatggaacatgctctgtcagctacattcccgtg
gaggagggagactatgacatccatatcaagttcgcagacgagcatatccctggcagcccc
tttacagccaaggcgggtcgcccggtggacccctccaaggtaaaatgccacgggcccggt
gttgaccgtgtcaacccactcttctcaaagactccgcagcgcttcaccgtggacaccaca
gaggccggtgtcgcgccacttgacgtgtctgtcgaaacccccaacaggcaaactatcaag
ccagacagcgtggtagaggagaagcctggaatccatgccgttacatacacgcctgaagac
gaaggtcgctacaaagtaaatgtcaagtacgcctcaacacacgtacctaatagccccttc
aacgtgcgtgccgggccacccttcgacgcatctaaagtaaaggtgtccggcccgggagtg
gacgagaccccatacacttgcgagcccgtcgagttcttgtgtgactgcagtgaggctggc
accgctcctttgggagtaaccgtgtcgccaccatctggacccgatctcaaaccagacgtg
aaggacaacggcgatggcacctacactgttgcatacgtcccggacaagcctggccgctat
aatattgacgtgaagtatggcgaccggagggtgccaaggagtccgttcagaccaactgtc
aagccaagcggagatgcttccaaggtgaaggtcaagggactaggacccaatgagaaagtc
atgaccaaccaagagaacgatttccttgttgacgcaagaaatgctgggaaaggaaccccg
gtttgtacatgcatcggacccaacaagaaagacgtccctgtagatgtggtccccaacaag
gacggaacttatagctgctattacactccagaagacgagggccgacactcggtggatgtg
aaattcgctggagacaatgtaccaggaagccccttcctggtcaaagccgagaagggtctg
gactttgacaagatcaagtgtgcgcctcgtaatcctgtcgacgaaccgcctgttaacaaa
gagctggtctacgctgtcgacgctgctgccgctgaacctgttcctggacaaggcctggtc
aatggttctctgctgacgccctctggaaagaaggagccagtcaaggtacgcaacaacaag
gatggcacctacgacgtggcatgtgtacccaagactcctgggccgcacgagttgacagtc
aagtacgatgaccaaccaattccaggaagtccattcaagtttaatgccgtagagggagga
ccaggagctgtcaaggccttcggaaaaggtcttgaacgcggtcttgctaaggaaccatgc
gaatttactgtcgttactcgggacgctggccccggaggcctttctcttgctgtagaaggc
ccgagcaaagcagaaatcaaatgccaagacaatggagatggctcctgcaacgtaacatac
gtcccagatgagcctggagaatacaacatcaacgtcaaattcgccgataaacatattcct
ggcagtccgttcttggctcagatctacaacacctgggacgatctcgacgctgccaaacca
cgcccaacagtgggtaaaccctgcgatgtcggtctggacattccagatctcccaccagat
gtatccgtcctcaagggaactttgaaacgaccatcaagcaacaaggaagagcccattgag
atccgtataaatgacgacgacagccttggcatcacgtttgtaccatacgagccaggagag
catctcataagcatcaagaagaacgggcgccatgtgcaaaacagccccttctccgtaatg
gtgcaggctcagagaataggggacgtgtatccagtgggacacaccgctgatgtaggtatc
cctggattggaagactttggcgatctgcgcaagttgactgctactctgcgtcgtcctcat
agcaacgcagaggagtccgttcatcttcacaagaacccagacaatagtatcagctgctct
ttcctacccagggagccaggcgagcactttcttaccgtcaagaaggacaaacagcccatc
cctggtagtcccttctctatcctcgtcgaggcggaggaaccgatcgaagccgtcggttgc
cctgtggattactgctttgatatcaaggatgatgtgaacctacctgatgagcttgacaaa
ctgaaagcgacgattacaagaccaaacactgacaaagaggaacctgtcggactcaagctg
aactctgacctctctctcagctgctccttcatcccccgagaaactggcatgcacctgatt
cacatccgaaagaacggccgtgatattactggaagccccttcccactgaatgtcactgcg
cctgaggctgttagccaggtgggccgcccatacggccttggcctggacttcgatggcgta
aacccctgcgacgactacgcccacctcacggccacactcaagagaccatcgtccaacaaa
gaagagaaactgaatttgctcctcaatggcgataacaccttgggcgttgcctttactcct
cgtgaggtcggtgagcatcttgtgcatgtgaggaaggacggctgcgagcttccagagagc
cccatttctatcatggtggtcggtaaagatgaaaaggtcgaagaggtccacccagtaaag
aagacgtgcgacctcagcctcgacatacctggagtcaccctcccagacgacttcaagaag
cttagtggatcacttaagaggccgacgagcgacaaagaagaacccttgactttgaccctc
aacaaaaaagacaacaccctaggagtgtcctttgttccagttgaacccggagagcacaaa
atcagaatcaagaaggaaggcaaggacgtgcccggaagcccttactccgtgatggtagaa
gctgctgaggctgtcaacgccgttggaaagccgtgtgactgctgtctacctggcagattc
gacgaagacgacctgaggaggctgaacgctacacttaagagaccatcaagtagaacagaa
gagccgctcaaacttaaactcaactctgacaagactctcagcgctgtgtttataccaaat
gaaacgggagagcatatcatcaatgtcaagaaattcggcaggcacatcgatggcagtcca
ttctctgtcatggttgtcgcaccagaggctaacgccattggaagaccatgtggcgtcggt
ctggagatccctggacttcgcctcccagaagacttcgacttactcacaggaagtcttaga
aggccatccaaaacatgcgaagattcgctcaaccttaccctgaactcggataacacactc
agtgtgtcgttcgtgcctcaggaaaccggcgaacacttcgttagcgtcaagaaatctggc
aaacatgtgactggtagtccattctcggtaatggtcagcggtcctggaccagccgacgcc
tcaaaggtcaaagtcactggcgatggtctccgcaagggagtcacaggcgagcccgctcgc
ttcactgtcaacacccgtgatgcaggctatggtggcttgggtctatctattgaaggcccc
tctaaagctgagatcaattgcgtcgacaacgaagatggcacgtgttccgttgattacctc
ccaacggagcccggcaagtacaccatcaacatcaagttcgcagacgagcacgttcctggt
agccctttcaaggcgaatatacggcgacctggtgaggaggagatcgtagcaatgtcggaa
gatggcgtcgagtctgaaccgacgcagcgagtaagccaagtgttcgaagacctcgtcagt
ttcggcgctgcggcaccacagccacacgacttcgtcttcgacctcaagggatacaatgta
gaagatttagagacgacagttatcagtccggatggcgaagttctgcctgcagagatagtc
gagagtggcaccaacagctataccatccgcttcatgccgaaagaaagcggcgagcacgtt
atcaacgtcaaataccgaggcagacatatctcgggaagtcccttcaaggtgtacgtagag
gcgccggtctggggtggcgccgcaaagtgcactgctgctggaccaggtttggaaagggga
gtggtcggtcaccctggtgacttcaccgtttggacgagggatgcaggacctggaggtctc
gccatcgctgtcgaagggcctgcaaaggcagaaatcacgtgccacgataacggcgatgga
tcgtgcaacatcagctacctccctactgcccccggagagtacactatccacatacgattt
gccgatgaagacatccccggaagtcccttcaaggttttcgttaccacagaagtagaagac
cgcttccgcgacctgaaactcagcgatcttgagagttccggtttaaaggtgggacaacca
gcatccttttctgtccagaccaacgctccagtaggtaaagtctcggcgactgtcatcgcg
ccctctggaaccgaatccaaagctgtcatctccgatctcgggaaaggcaactacgctatt
aggttcgtaccaaaagagttcggcgatcacttggtgaatgttaaattcgacgagacccac
attcccggcagcccgttcaagatccgtgtcggtggaggcggtgctcaccctgagaaggtc
aaggcgtacggtcctggtctgagcagtggtcatgctggaaaatcagcagaattcacagtg
aatgcgctagaagcaggctctggagcgctcgctctgtctgtagatggcccagccaaggtc
aagatgaattgcacagagaatcaagatggcacctaccaggtcacctactacccagtagtt
gctggagagtacaccattagtataaagttcgcaggtcaacacatccccgacagtccttac
aacgttaccatcttcccgccaagcgggcacctccagcacagcgaaggcgacgcgtccaag
tgtacctcccgaggaaccggtctacacagggcagttctcggtcaacccaactccttcacc
gtcaacgctagtaacgccgggcgaggctctctcatggtcggcgtggaaggacccgcaatt
cccgcgaaagagattaacgtcaagcacactggcagcaacgtgtacgctgtaaactacgcc
cttgaagagccgggaacctacattctgaaggtgctttggggcgaaaagcatatccctgga
agtcctttccacgtaactgtctaa

DBGET integrated database retrieval system