KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g240395Help
Entry
NEMVE_v1g240395   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g240395
Translation factors [BR:nve03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NEMVE_v1g240395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 247 aa AA seqDB search
MADWDDEKFEPGEVPADGVTDKWEGEDEDDDIKESWDDDDEDEKKEDEAKNTEAAAPKKK
KTLKQILKEKEEQKLLEEKRKAEEKQKLEEEDKELTPEEQMAEKLRRQKIVEESDLLVAM
DTFGVGTQEEASRTGLDSMIPSTKEEFTEYSKLLVEKLTKFETNPEYIPFLEATLREICV
SLDPEDIKKLSSTLNMLQSEKLKAQKGKKAKSKATKKATLTGGAKMGRKDEMDYSYGDLG
NEYDDFM
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggactgggatgatgaaaagtttgaaccgggtgaagttcccgccgatggtgtaaca
gataaatgggaaggcgaggatgaagatgatgatattaaggaaagctgggacgatgacgat
gaagacgaaaagaaagaggatgaagcgaaaaatactgaagctgctgcgcccaaaaagaag
aaaacactcaaacagattctgaaggaaaaagaagagcaaaaacttttagaggaaaaacgg
aaagctgaggagaaacaaaagctagaagaggaagacaaagaactaaccccagaagaacaa
atggctgaaaagcttagaagacaaaaaattgtagaagaatcagatttattggtagcaatg
gatacatttggtgttggcacacaggaggaagcttctcggacaggattggattccatgata
ccttccaccaaagaagaattcacagaatacagtaaattactggtagaaaaattaaccaag
tttgagaccaatccagaatatatcccatttttagaagcaactcttagagaaatttgtgtt
agcttggacccagaggatataaaaaagctttctagtactttgaatatgttgcagtctgaa
aaattaaaagcacaaaagggtaagaaagcaaaatctaaagcaactaagaaagccacacta
actgggggcgcaaagatgggaagaaaagatgaaatggactactcatatggggatcttgga
aacgagtatgatgacttcatgtga

DBGET integrated database retrieval system