KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g240549Help
Entry
NEMVE_v1g240549   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:nve03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 957 aa AA seqDB search
MAAEESSLCKISTDLGSYYLLTKLYNGGRDGLEMTICNGENIWRGKVSPEEISSMAEAID
TELESYTQQMVKAFTGKRTDTENFVYQTTIENNELKFYWKKQLADGVKFQLGCVDFSTVD
TPRPMNMILDFAVSEITTLKREIVQKTEDNGRLANERRKAVKLLDECVKSKVELESDLYQ
KFAIVLNEKKAKIRQLKSQVEDSSSGVTGHDRQEQAEETGSNKSSMCNENATTDMTDFSP
SLAEKEPIKPAAKRRKRREPKPVATPKGKVVLPNVPLTKTPSTSSEDSLEVGRRDSIQGF
LYFVIDAAGVLWIKQPPKPTIVFLGRNSTEVELRWDFDLQSTNFVFGKLEVYKEKEGGSE
VTIKNSILPGDKGNILSDGRYDVDVNIPATGASDKKGYLKLTIEDVVKQGDIDPEKEDVY
VYRFEFTDSSRTEYKSEVPLRAYRTPSFVSYPANSSVSAGVSVKLTCEVIGKPTPRVTWT
KLGDPNWRSVEAITSINNFQIADRGVYMCTASNGFEPNITAVSVVQYSGCTNECAKQTVG
IQMTDLTWTVNYQLKQLYTEEIKDLASRIVYEIAEQYQKQNKNLYLVEVERFRSKSTDVL
KFIYKTKPDFVALVETWFQPNDVAARREIVPSCYRLVDYPRDDRKGGGIGILFNENITVK
KVRFKELTTDDVRALIDQGSKKSCPLDPMPTSLVFQCLDELIPVITSMINLSLQSGSFAD
EWKDGLVNPLLKKAGLEQTKANLRPQPGNTVDLKPLEDMIATGSLAGQTVKRNFVSTTDG
KIRYSTFVSTTDAPSPSPTPSPSSETTPKPGPPPDTGARSSGGISDTALYAIIGVIAAVV
VIAVIILIVCFVQRKKKGDTRKGDKYQQDGKQYKPPPPASQPLTKLDDYPYDNANSQTPK
ELDYAELNFQNRYPNGEEHYPPPQYEPTAYAEVGHAKPNKDDSEVEWDKSVNDGMWI
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaagaatcgtctttatgcaaaatttccacagatttgggaagttattatttg
ctaactaagctatataatgggggcagagatggactagaaatgacaatatgcaatggagag
aacatttggcgtggcaaggtttcaccagaagagatcagttctatggcagaagcaattgac
acagaactagaatcgtacacacagcaaatggtgaaggcttttactggcaagaggacagat
actgaaaactttgtctatcagacaacaatagaaaataacgaactaaagttttattggaag
aagcagcttgctgatggggtcaagtttcagctaggatgtgttgacttctccactgttgac
acaccacgaccgatgaacatgattcttgactttgccgtcagtgagataacaactcttaag
agagaaatagtgcaaaaaacagaagacaatggcagacttgcaaatgaaagaagaaaagct
gtcaagcttttggatgagtgtgtaaaaagcaaagtggagctagaatcagatctatatcag
aagtttgcaatagtactgaatgagaaaaaagcaaagatacgacagttgaaatcccaagtt
gaagattccagttctggtgtaaccggacatgacaggcaagaacaagctgaagaaactggt
tcaaataagtcatctatgtgtaatgagaatgccacaacagacatgaccgactttagcccg
tccttggctgagaaagagcccataaagcctgccgcaaaaaggagaaaaagacgagaaccc
aaacccgtcgctactccaaaagggaaagtcgttcttcctaatgtgcctttgacaaaaacg
ccaagcacctcttccgaagatagcctagaagttggtcgcagagatagtatacaagggttt
ctttattttgtcattgatgctgctggtgttttatggataaaacaacctccaaagccaacg
atagtctttctagggcgtaatagcactgaagtagagctaagatgggacttcgatctgcaa
tcaacaaactttgtattcggaaagttagaggtctacaaggagaaggagggaggttcagaa
gtaacgataaagaattcgatcctgccgggggataaagggaatattttgtcagatggtcgc
tacgacgttgatgtcaacatcccagcgactggtgcttcagacaagaagggatatttaaaa
ctcacgatagaagacgtcgtgaagcaaggagacatcgaccctgagaaagaggacgtctac
gtgtacagatttgaatttactgactcgagtcgtaccgaatataaaagcgaagttccccta
cgagcataccgcaccccttcctttgtgtcataccctgctaactccagcgtgtcagctggt
gtgagtgtgaaattgacatgtgaggtgattgggaagccaacaccaagggtcacttggacc
aaacttggtgacccaaactggcgcagcgtagaggccatcaccagtataaataatttccag
attgctgataggggtgtctatatgtgtactgcatcaaatgggtttgagccgaatatcacc
gctgtctctgttgtgcagtattcaggatgtactaatgagtgtgctaaacagactgtgggg
attcagatgacagacttgacatggacagtaaattatcaacttaaacaactatacaccgaa
gaaataaaagatctagcgagcagaattgtgtatgagattgcagagcagtaccaaaagcaa
aataaaaacctctatctggttgaagttgaacgcttcagatctaaatctacggacgtcctt
aaatttatttacaaaacgaaacctgattttgttgctttagttgagacatggtttcagcca
aatgatgttgcagccaggcgtgagatagtcccatcttgctacaggcttgtcgactacccg
cgtgatgataggaaaggaggcggaattgggattctattcaacgaaaacatcactgttaag
aaagtccgtttcaaagaactgacaactgatgatgtgcgggctctcattgaccaaggctct
aagaagtcttgtcccctagacccgatgccgacaagtttggttttccagtgtcttgatgaa
ttaattcctgtaatcacgtctatgatcaatctatctcttcagtcgggttcttttgccgat
gagtggaaggatggcctcgtcaaccccctgctaaagaaggcaggccttgagcaaaccaaa
gccaatcttcgcccgcagcctggaaacactgtggacttaaaacctcttgaagacatgata
gcgacaggaagcctggctggacaaactgtaaagaggaactttgtcagcacaacagatggt
aagattcgttatagtacctttgtcagcacaacagatgcaccatcaccctcaccaacacca
agcccgtcctctgagacaacacccaagcctggccctccgccagatacaggtgcaagatca
agtggtggaatctcagacactgcactgtatgctattattggagtaattgcggcagtcgtg
gtcattgcggtcatcattcttatagtctgctttgtgcagaggaaaaaaaaaggagacaca
cgtaaaggtgacaaatatcagcaagatggaaaacagtacaaaccacccccgcctgcgagc
caacctctcaccaagctagatgactacccttacgacaatgctaattcacagacacctaaa
gagttggattatgctgaactgaatttccagaaccgctacccgaacggcgaagagcactac
ccgccaccacagtacgaacctacagcttatgcagaggtcggtcacgcaaagcccaacaag
gacgacagcgaagtggaatgggacaagtcagttaacgatggaatgtggatttaa

DBGET integrated database retrieval system