KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g240980Help
Entry
NEMVE_v1g240980   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    NEMVE_v1g240980
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     NEMVE_v1g240980
Protein phosphatases and associated proteins [BR:nve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     NEMVE_v1g240980
Transcription machinery [BR:nve03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     NEMVE_v1g240980
Spliceosome [BR:nve03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    NEMVE_v1g240980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 328 aa AA seqDB search
MAEPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKKFPYGGLNSGRPVTPPRGQQQKAKKK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccggagaagttaaatgttgatagtataatatctcgtcttttagaagttcga
ggctcgcggccaggaaagaatgtacaactcacagaagcagaaattcgtggactttgttta
aaatctcgagaaatattccttagtcaaccaatcttattagaactagaagcaccgctcaaa
atctgtggagatatccacggccagtattatgatctgctaaggttgtttgaatacggtggt
ttccctcccgaatcgaactacctctttcttggagattatgtcgatcgaggcaagcagtcg
ctggaaacgatatgtctcttgctagcctacaaaatcaaatacccggagaacttctttctc
cttcgaggaaaccacgaatgcgctagcataaaccgaatttatggattctacgacgaatgt
aaaaggcgatataatataaagttatggaagacttttacagactgtttcaattgcttgcct
gtcgctgccatcttagatgaaaaaatattttgctgtcatggaggcctttcccccgatctc
caatcgatggaacagattcgaaggattatgcgaccgacagatgtacccgatcaaggattg
ctctgtgatctgctgtggtctgacccagacaaggacgttcaaggatggggggagaacgac
aggggtgtgtcattcacctttggaccagacattgtagcaaagtttctccacaagcatgac
ctagacctaatatgtagagcacatcaggttgttgaagatggctacgagttcttcgccaag
agacagttggtgacactcttctcagctcccaattattgtggagagtttgataatgcaggt
gccatgatgagcgttgacgagacactcatgtgctctttccagattttaaagccagctgac
aaaaagaagttcccatatggagggcttaactctggtcgccccgtcacccctccccgaggc
cagcaacaaaaggccaagaagaaatag

DBGET integrated database retrieval system