KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241128Help
Entry
NEMVE_v1g241128   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Ribosome [BR:nve03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    NEMVE_v1g241128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 244 aa AA seqDB search
MAAKLSRILLQTPARFTNLSTSVFLSGRSILNGGLPGSFAGVRGLFILHKRNEDDFLTRK
GPLMPTESSHRWRPISRNISTDSSTSTEFPLSNDENNTVNVCKKLTLDDIVSQWPEVKPA
WAGYRRNHKGQIPPKRTRLRCTTIDKQLLTQNPCPVCRIRVEKNYEISSKDVSFLTQFMS
PHTGEILHTGKTGVCRQQQKKLLHAIEEAQDKGYLPFTISGPRDPPKPWRAAGVVSNNIR
NKTG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaagttgtcgagaattttattacaaaccccggcaagatttaccaacctctcc
acatctgtttttttatcaggtagaagtatattaaatggaggactgcctggatcatttgca
ggggtaagggggttgtttatattgcataaaagaaacgaagatgacttcttgacaagaaaa
ggccctctgatgccaactgagagctctcatcgttggagacctatttcaagaaatatttcc
accgattcaagtacttcaacagaatttccactatccaatgatgagaacaacacagtcaat
gtttgtaaaaagttaacattggatgatattgtatcacagtggccagaagtgaaaccagcc
tgggctggatataggagaaatcataaaggccaaattccacccaagagaacaagactgcgt
tgtacaacaattgacaaacagctgctcacgcagaacccatgccccgtttgtcgtatccga
gtggagaaaaactatgaaatcagtagcaaggatgtttccttcctgactcagtttatgtcc
ccacacacgggcgaaattctgcacactgggaaaacaggggtttgccgtcagcagcagaaa
aagctcttacatgcaatagaagaggcacaagataaaggttaccttccattcacgatctca
ggaccacgggacccacccaaaccctggagagctgctggtgttgtttccaacaacatcagg
aataagacaggatga

DBGET integrated database retrieval system