KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241446Help
Entry
NEMVE_v1g241446   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nve00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:nve00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 463 aa AA seqDB search
MSSFRIEELIALKRDGFDLTAEQIKHFVERVVAKDIGDSQIGAMLMAMFLRGLNSEETVH
LTRAMIDTGELLKWPEEWKGSIGDKHSTGGVGDKVSLPLAPALAVCGVKVPMISGRGLGH
TGGTLDKLESIPGYRFGLSPVEMKKSLTDVGCCIAGQTDTLAPADRVLYSLRDITGTVAS
NPLIASSIMSKKASENLDALVLDVKCGRAAFTAKTPELARIFAVTLYKTCAGLGIKCAAL
ITNMDHPIGLTVGNSVEVAESVRCLNGQGPEDLQELVCAQGGHLLKALNKVDSAEEGFNK
IKTSLHNGTALRKFQEMLSAHGVSPDTANALCTPGADPYVVLPLAPQKTELRANKPGIVR
DINAMACASVCGRLGAGRQKSTDAVDHSVGLILHVRVGQYVHKGDVWVCVHHKGNLDKEG
IECLEKAIMIVESEKTESLPVESRIIEVIDSLSVRKSSLFTSQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtttagaatagaagaactgatagctttgaagcgcgatggttttgatctaaca
gctgaacagattaagcattttgtggaaagagttgtcgccaaagatatcggcgactcgcaa
ataggagccatgttaatggcaatgtttttacgcggtttaaactcagaggagaccgtccat
ttgacacgagcgatgatagacacaggcgagctattaaagtggccggaggaatggaaaggc
tcgattggggacaagcattctactggcggagttggggacaaggtgagtctgccgctagcg
ccagccctggcagtgtgtggagtcaaagtcccaatgatttcgggtcgtggattgggccat
acaggtggcaccctagacaaactggagtctattcctggttatcgctttggcttgtccccc
gtggaaatgaaaaagtcgctgaccgatgtcggctgctgtatcgcgggccaaacggacacg
ctagcaccagctgaccgagtgctttacagcctgcgagatattacgggaaccgtggcgtcc
aaccctctcatcgctagctcaatcatgtccaagaaagcttcagaaaacctcgacgcgctt
gtccttgatgtaaagtgtggtcgcgccgcgttcacggccaagaccccggaactagcgcgc
atattcgcggtcacgctgtacaaaacgtgcgcgggcctaggaatcaaatgcgccgcccta
ataactaacatggaccaccccattggtcttaccgtggggaactcggtcgaggtggctgag
tcggtgcgatgcctgaacggtcaagggccggaggatctgcaggagttagtctgcgcacaa
ggtggtcatctgctcaaagccctgaacaaagttgactcagccgaggaaggattcaacaag
attaagacctcccttcacaacggcacagccctcagaaaattccaagagatgctatccgca
cacggggttagcccagacacggccaacgccctttgcacccctggagctgatccttatgta
gtattacccctagcccctcagaaaacagaacttcgggctaacaaaccgggaatcgttagg
gatatcaatgcaatggcgtgcgcgtcagtgtgcggaagactgggagcaggcaggcagaag
agtacagatgcggtggaccatagtgttgggttgatacttcatgtaagggttgggcagtat
gttcataagggagatgtgtgggtttgtgtacatcataaggggaaccttgacaaggagggc
atcgaatgcttggaaaaggcgatcatgatcgttgagagcgagaagacggaaagcttacca
gtagagtcgagaattattgaggtcatcgactctttaagtgttcgaaagagcagcctcttt
actagccagtag

DBGET integrated database retrieval system