KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241446Help
Entry
NEMVE_v1g241446   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NEMVE_v1g241446
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    NEMVE_v1g241446
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NEMVE_v1g241446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 463 aa AA seqDB search
MSSFRIEELIALKRDGFDLTAEQIKHFVERVVAKDIGDSQIGAMLMAMFLRGLNSEETVH
LTRAMIDTGELLKWPEEWKGSIGDKHSTGGVGDKVSLPLAPALAVCGVKVPMISGRGLGH
TGGTLDKLESIPGYRFGLSPVEMKKSLTDVGCCIAGQTDTLAPADRVLYSLRDITGTVAS
NPLIASSIMSKKASENLDALVLDVKCGRAAFTAKTPELARIFAVTLYKTCAGLGIKCAAL
ITNMDHPIGLTVGNSVEVAESVRCLNGQGPEDLQELVCAQGGHLLKALNKVDSAEEGFNK
IKTSLHNGTALRKFQEMLSAHGVSPDTANALCTPGADPYVVLPLAPQKTELRANKPGIVR
DINAMACASVCGRLGAGRQKSTDAVDHSVGLILHVRVGQYVHKGDVWVCVHHKGNLDKEG
IECLEKAIMIVESEKTESLPVESRIIEVIDSLSVRKSSLFTSQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtttagaatagaagaactgatagctttgaagcgcgatggttttgatctaaca
gctgaacagattaagcattttgtggaaagagttgtcgccaaagatatcggcgactcgcaa
ataggagccatgttaatggcaatgtttttacgcggtttaaactcagaggagaccgtccat
ttgacacgagcgatgatagacacaggcgagctattaaagtggccggaggaatggaaaggc
tcgattggggacaagcattctactggcggagttggggacaaggtgagtctgccgctagcg
ccagccctggcagtgtgtggagtcaaagtcccaatgatttcgggtcgtggattgggccat
acaggtggcaccctagacaaactggagtctattcctggttatcgctttggcttgtccccc
gtggaaatgaaaaagtcgctgaccgatgtcggctgctgtatcgcgggccaaacggacacg
ctagcaccagctgaccgagtgctttacagcctgcgagatattacgggaaccgtggcgtcc
aaccctctcatcgctagctcaatcatgtccaagaaagcttcagaaaacctcgacgcgctt
gtccttgatgtaaagtgtggtcgcgccgcgttcacggccaagaccccggaactagcgcgc
atattcgcggtcacgctgtacaaaacgtgcgcgggcctaggaatcaaatgcgccgcccta
ataactaacatggaccaccccattggtcttaccgtggggaactcggtcgaggtggctgag
tcggtgcgatgcctgaacggtcaagggccggaggatctgcaggagttagtctgcgcacaa
ggtggtcatctgctcaaagccctgaacaaagttgactcagccgaggaaggattcaacaag
attaagacctcccttcacaacggcacagccctcagaaaattccaagagatgctatccgca
cacggggttagcccagacacggccaacgccctttgcacccctggagctgatccttatgta
gtattacccctagcccctcagaaaacagaacttcgggctaacaaaccgggaatcgttagg
gatatcaatgcaatggcgtgcgcgtcagtgtgcggaagactgggagcaggcaggcagaag
agtacagatgcggtggaccatagtgttgggttgatacttcatgtaagggttgggcagtat
gttcataagggagatgtgtgggtttgtgtacatcataaggggaaccttgacaaggagggc
atcgaatgcttggaaaaggcgatcatgatcgttgagagcgagaagacggaaagcttacca
gtagagtcgagaattattgaggtcatcgactctttaagtgttcgaaagagcagcctcttt
actagccagtag

DBGET integrated database retrieval system