KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241973Help
Entry
NEMVE_v1g241973   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nve00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:nve00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:nve00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:nve00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nve00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nve04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 971 aa AA seqDB search
MAAKIDLRYDVISNLQGDGRYSAKLTLTNTGTTVITKGDWDLVFCSIRLIVPDSSTERAG
VKVSHINGCLHKMTPLETFPVLAADQNVEIPFRAMNWVVAKTDIMPNWFFAADGLEPRVV
KSTEGEGLSFVGKFTTEEQWKRYANDQYNPYTAQGRYDVIGFDDLGEDGWGDIVTIPQPM
TVQGLERKSRVGIRADWKIFADGGFQKEAQLLKAKFNAQIASSMPFNQSKLIRLVKGDPN
VTRGVASSEAYSLEIKVAEKEIKLTGSHASGVFYGVQTLIALADKENTVPMVTIKDAPRY
GYRGMHLDVGRNFMEKAAVLKLLDAMATYKMNKFHFHLTDDEGWRLEIPGLEELTTVGSK
RCYDINTTRCILSQLGSGPSPSTSAQYYSVSDYKEILKRANDLHIQVIPEFDMPGHGYAA
IKSMEARFKRLKDSNPSEASKYILSDFNDTSKYLSIQYFTDNAINPCIESTYAFIEKVLT
EVKSMHKDIQPLTVYHFGGDEVAHGAWTKSSACEQLAQRMGYNLTGSDIVDKLKGYFVER
VANITVNDGLSLAGWEDGLLGHGEVPYNRKSFRNSNVMAYAWNNIWEWGSGKRAYLLANA
GYKVVMTQATHLYFDFPYEPDPQERGYYWATRFTDTRKTFGFMPDNLFNNVEQKVTGEPL
TREELCKTEGMCVELVKKENIIGMAGALWTETVRTADQMDSMIFPRLLAVAERAWHKASW
EDISDKTERNNKRSEAWKRFATYLGHLEMTRLDAMKIKYHLPPPGARVENSKLKVRTAIQ
GLPVQFSKDDGKTWSDVTDSTEVRGKLVLRTKSADGTRQSRLVTLNMDVSVASRLSVARE
KGTTKAQRVPFEKKNSPIGRQRQGKGYRKEHRSTQEINKNIRFMILESNQEFKQKFHVFN
LRVQDLAREAEEKESIIRERESEISALSMEHEDALEREHQYQKELDYAWKRILRCENKIR
HLIDELEFYRT
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaaattgatctgcgctatgacgtcatctccaatctccaaggcgacggaagg
tatagtgcaaagctcacactgacaaacaccggaacgaccgtgataaccaagggggactgg
gacctggtattttgctctataaggctcattgttccggacagcagcaccgaaagagcggga
gtgaaagtcagtcacattaacggctgtcttcataagatgacgccccttgagactttccct
gtattggcagccgatcagaatgtagagattccttttagagcaatgaactgggtcgtcgcc
aagacagatattatgccgaattggttttttgccgcggatggactggagcctagagtggtg
aaaagtactgagggggaggggctaagttttgttggcaaatttaccacggaagagcagtgg
aagcgatatgcgaacgatcaatacaacccatacacagctcaaggcagatatgacgtcatt
ggttttgatgacctcggggaggatgggtggggagatattgtcaccattccacagccaatg
accgtgcagggcctggagaggaaatcacgtgttgggattagagctgactggaagattttc
gctgatggcggattccagaaagaggcacagcttctcaaagctaagttcaatgcgcaaatc
gcatcttccatgccattcaaccagtcaaagctcatccgattggtcaagggtgatcctaac
gtcacaagaggcgtggcttcgtctgaggcgtacagtctcgaaatcaaggttgcagaaaaa
gagataaaactgacgggtagccatgcatccggggtcttctatggcgtacaaaccctgatt
gccttagctgacaaagaaaataccgttcccatggtaaccatcaaggacgcccctagatac
ggctatcgcgggatgcaccttgatgttggacggaacttcatggagaaagccgctgtcctg
aagctgttggatgccatggcaacatacaagatgaataaattccattttcaccttacggac
gacgagggctggagactagaaatccctggactggaggagcttacgacggttggctccaag
cgttgctatgacatcaacaccaccagatgcatcctttctcagctaggttcaggcccctct
ccgtccacctccgcccagtactactctgtcagtgattacaaagaaatcctgaaacgcgcg
aatgatcttcacattcaagttatccccgaattcgacatgccggggcatggttacgccgca
atcaaatccatggaggcgaggtttaaacggctgaaagattcaaaccccagcgaggcttca
aaatatattttatcggacttcaatgacacttcgaaatatttatccattcagtatttcacg
gataatgccatcaatccttgtattgaatcaacttacgcttttattgagaaagtcctcacc
gaagtcaagagcatgcacaaagacatccaaccgctgaccgtgtatcactttggcggggac
gaagtggcgcatggggcctggaccaagtccagcgcctgcgagcaattagctcagcggatg
gggtataaccttaccggaagtgacatcgtggataagctgaaggggtatttcgttgagcgc
gttgcaaacataactgttaatgacggcctcagtctagcgggctgggaagatgggttgtta
ggacacggcgaagtcccgtataaccgaaagtcgtttcgaaattccaacgtgatggcgtat
gcgtggaataacatctgggagtgggggtctgggaagagggcgtatctactggcgaacgct
gggtataaggtggttatgacccaggccactcacctttacttcgacttcccgtacgagcct
gacccgcaggagcgtgggtactactgggcaactcgattcaccgacacccgaaaaacgttc
ggatttatgcctgataacctgttcaataacgtcgagcagaaagtcacaggagaacctcta
acacgagaggagctttgcaagactgagggcatgtgtgttgaacttgttaagaaggaaaac
atcattggcatggcgggagccctgtggaccgagaccgtgcgaaccgctgaccagatggac
agcatgatcttcccgcgtcttctcgctgttgcggaacgcgcgtggcacaaggcatcatgg
gaagacataagcgacaagactgagcgtaacaataagcggtctgaggcatggaaacgattc
gccacctacttagggcatctcgaaatgactaggcttgacgctatgaaaatcaagtaccat
ctaccaccccctggggctagagtcgagaactcaaagctcaaagtccgaactgctatacaa
gggctacctgtacagttctcaaaggatgatgggaagacatggagcgacgtaactgattcg
acggaagtgcgtggcaaactcgtgctgcgcacaaagtcagcggatggcacccgccagagc
aggctcgtaacattgaacatggatgtgtctgttgcttcacgcctttcggttgcacgggag
aagggaacgacaaaggctcaaagagttccttttgagaaaaagaatagtcccattggtcga
caaagacaaggaaaaggatatcgaaaagaacaccgatctactcaagagattaacaagaat
atccgatttatgattttggagtcaaatcaagaattcaaacaaaagtttcatgtcttcaat
cttagagtgcaagatttggcaagagaagcagaagagaaagaaagcatcatacgtgaaaga
gagagtgaaatcagtgcgctttcgatggaacatgaagacgcacttgaaagggaacatcag
tatcaaaaggagttggactatgcgtggaagaggatattgagatgcgagaacaagatcagg
catttaatagatgaactcgaattttaccggacttga

DBGET integrated database retrieval system