KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g242260Help
Entry
NEMVE_v1g242260   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K10260  
F-box and WD-40 domain protein 7
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Ubiquitin mediated proteolysis
Module
SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NEMVE_v1g242260
Ubiquitin system [BR:nve04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     NEMVE_v1g242260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 616 aa AA seqDB search
MASVDINRATPKELEHLNGIGKNKANYIIEFRDALGGFSCVDDLSKVPGIGPHLLEANRS
DLHCSPAKEPPETTEQEEASPPKKLCTKPKTVRILPHKSYGRIKTDTCAVSAIEPRCRRT
SFCTQPPAGLKDWIQVFQQWDPEEKKYAIEEIIETCEPSLVRHMMGTIEPRFQRDFISLL
PRELALYVLSFLEPSDLLHAAQTCKCWQILCEDNLLWKQKCREAGITEDPHGTSKLPRRR
STQTQNNTAPTPTTKHHPSPYKKLFMVKQKIYWNWRRGPLRPSKILKGHDDHVITCLQFS
GSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAET
GYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYD
GHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAET
GQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCL
QFSSKFVITSSDDGTVKIWDLQTGEFIRDLVKLDSGGSGGVVWRVKCDEKKLVCAVGSRN
GTEETKLLVLDFDAQE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtggatattaaccgtgcgactcccaaagaattggaacatctaaatgggatt
ggaaaaaacaaggcgaattatattattgaatttcgtgatgcgcttggagggttttcatgt
gtggatgacctttcaaaggtacctggtataggaccacatttacttgaagcaaacaggagt
gatttgcattgctctcctgcaaaagaacctcctgaaacgacagagcaggaggaggcaagc
cctcctaagaaattatgtacaaagcctaaaacagtgagaattctccctcacaaaagctat
ggcagaataaagacagacacttgtgctgtatcagcaattgaaccccgctgccgaaggaca
tccttttgtacacagcccccagcagggttgaaagactggattcaggtcttccagcagtgg
gacccagaagaaaagaaatatgccattgaagaaattattgagacgtgtgagccgtctctg
gtgcggcatatgatgggtacaattgagccgcgattccagagggattttatatctctgcta
cccagggaactggctttgtacgtattgtcatttctagaaccaagcgaccttctccatgca
gcacagacgtgtaaatgctggcagatactttgtgaggataacttattatggaaacaaaaa
tgccgcgaggcagggatcacagaggaccctcacggcacctccaaattaccacgacgacgc
agcacccaaactcaaaacaacaccgcaccaacccctactactaaacaccacccaagcccc
tacaaaaagctctttatggtaaagcaaaaaatctactggaattggcgacgtggacctctg
cgtccctcaaaaatcttaaagggtcacgatgaccatgtgattacatgtcttcagttctct
gggagtcgagtggtcagtgggtcagatgatggcaccttgaaggtgtggtcagcactaagt
gggaagtgcctgcgtactctgacaggccatactggcggagtatggtcctctcagctgagt
ggccacattattgtcagtggctcaactgatcgaactttaaaggtgtggaatgcagagact
ggctattgtatgcacacgttgtatggacacacttcaactgtgcgctgtatggacatgcat
gaggaggtggtggtcagtgggtccagggatgggaccctcagggtttgggacaccactact
ggcaactgtctgcatgtgcttgttggacacctagctgctgttcgatgtgtgaagtatgac
ggtcaccgcgtggtcagtggtgcgtatgacttcctggtgaaagtctgggatcccgagaca
gagcagtgcatacacactctacaaggacacaccaacagggtgtactccctgcagtttgac
ggcacttacattgtcagtggctcgcttgatacatcaataagggtgtggcacgctgaaaca
gggcagtgtctacacacacttgtgggccaccagtctttaacaagtggtatggagttacgc
aataacaccctggtgtctggcaatgctgactctactgtcaaaatctgggacattacaacg
ggacagtgcctgcagaccttggcagggccaaacaagcatcagagtgcagtgacatgttta
caattcagtagcaagtttgtgatcactagttctgacgatggtacagtcaaaatctgggac
ttacaaactggggaatttatccgggacctggtaaagctggatagtgggggcagtggtggt
gtggtctggagagtgaagtgtgatgagaagaaactggtttgtgctgtcggtagccgtaat
ggcactgaagagaccaaacttcttgtactggattttgatgcgcaggagtga

DBGET integrated database retrieval system