KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g242402Help
Entry
NEMVE_v1g242402   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NEMVE_v1g242402
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    NEMVE_v1g242402
   04068 FoxO signaling pathway
    NEMVE_v1g242402
   04070 Phosphatidylinositol signaling system
    NEMVE_v1g242402
   04150 mTOR signaling pathway
    NEMVE_v1g242402
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     NEMVE_v1g242402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1041 aa AA seqDB search
MAPVSRLDMWASLSACTPVDVDCLLPTGVLIPIEVRIEATLGEIKNKLWREAASYPLFNL
LKEMSSYVFVCVNLQGKQEELVDENRQLIDVRPFRPMLKLIEKKGDREEKLLSSKISVLI
GKNLHEFDQMKNPEVDEFRRRYAEYVEGIAKERSKLDWEGRAMYAYPVEIEQSEETPAYV
AQKLNENRRFLISVAIRNNRASMKDMHAFNVSADTFPEELLVLVLKKRGAIMGVQDFDNP
KDYVLKIVGRESYLLGEYSLLRYRYISECIAQGKRPQLSLVRRVSLGVNELMDVSGKSGI
QHRPPPPLPPKVESAELSLWSIETQLRVKILSADNINVGDVMMVGVRGAIYHGNEVLSDI
KQTKPQSGNKPLWNEFINLNILVCDIPRMARLCLVLFGVYVKAAARRKKKNLDYIPLAWV
NVTLFDFRGNLRQGPLTIHAWPVPETMPDLLNPIGTVVSNINTSTSPCLVIEFQRYANNV
VYPAYDKILQLAAETTDQEIFKKTGDNELEQLRQVIDREPLAPIFELDKEFVWRARMECR
DYYPHSLGRLLSCVKWNCKEDVAQMQVLLQIWPEMHPELALELLDCNYADQKVREFAVRC
IEKMGDSDLMHYMLQLVQVLKYESYLDCELARFLLKRTLNNQNLGHELFWLLRAEMHNPE
VSVRFGLMLEAYCRGSPAHMKSLQKQLEALNKMKTISSLLQHVDRDKRAQGLQTMKECLQ
QKTYQDALSRLTSPLNPSYRLKQLKVDNCKYMDSKMRPLWLDFENFDELGEPVKIIFKSG
DDLRQDMLTLQLIRIMDRLWKKDGLDLEMIPYGCLSTGDHVGMIEVVTNSETIAKIQMKQ
MGAITGAFNKTCILDWLADRNGSKEALVEATHRFMLSCAGYCVATYVLGVGDRHSDNIMV
HENGQLFHIDFGHFLGNFKNKFGIRRERVPFVLTDHFVHVITRGNDNTEGFQEFRRICEQ
AFLVLRRRGSLLINLFVMMLSAGIPELRSLDDIGYLRKTLNLNVSEEKALEYFNRKFNEA
VDNSWKTSINWAIHNKVRDNP
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgtgagccggttggatatgtgggcatccctgtctgcatgtacacccgtagat
gtggactgccttcttccaactggagtgctcatccctatcgaagtacgtatcgaagccaca
cttggggaaataaaaaacaagctatggcgggaagcagccagctatcctttattcaatctc
ctgaaagagatgtccagttatgtcttcgtgtgtgtgaatttacaaggcaaacaagaagaa
ctagttgatgaaaatcggcaactgatagatgttcggcctttccgtcctatgcttaagctg
atcgagaaaaaaggcgatcgtgaagagaaattattaagttctaaaattagtgtcttgatt
ggaaaaaaccttcatgagttcgaccaaatgaaaaaccccgaagtcgatgaattcaggcga
agatatgccgaatatgttgaagggattgctaaggagcgaagcaagttggactgggaggga
agggccatgtatgcttacccagtagaaatagaacagagcgaagaaaccccggcttatgtc
gcccaaaagctaaatgaaaatcgcaggttcctgatcagcgtagcaataagaaataatagg
gcatcaatgaaggatatgcatgctttcaatgtatcagctgatacttttccagaggaacta
ttggtattagttttgaagaaaagaggggctatcatgggtgtccaagattttgataaccca
aaagactatgtactgaagattgttggcagagaaagctatcttttgggggagtactctttg
ttgcgatacaggtacatcagtgaatgtatagcccaaggaaaaagaccacagttgtcatta
gtgcgacgggtttcgttaggagtgaacgagctcatggatgttagcggcaagtctggtatt
cagcatagaccacccccaccactgcctccaaaggtggagagtgcagagctttctctttgg
agtattgaaactcagttgagagttaaaatcttgtctgcagataatatcaatgttggtgat
gttatgatggttggagtcaggggagcaatttaccatggcaacgaagtgctcagtgacatc
aaacagacaaaaccccaaagcggcaacaaacctttgtggaatgagttcatcaacttgaac
attctagtgtgtgatattccccgaatggcacgcttgtgcctagtgttgtttggtgtgtat
gtgaaagctgctgccagaagaaagaaaaagaatcttgattatatccctctggcttgggta
aatgtaacattgtttgatttccgcggtaacctgcgacaaggacccctcaccatacatgcc
tggccagttccagagaccatgccagatcttctgaatccaattggtactgtggtgtccaat
atcaataccagtacttcaccttgtctggtgattgagttccaacgctacgcaaacaatgtt
gtttatcctgcttatgacaagattttacagcttgcagcagaaacaacagaccaggagata
tttaaaaaaaccggagacaatgagcttgagcaattgagacaagtcattgacagagagccc
ttggcaccaatctttgagttggacaaagagtttgtctggagggcaaggatggagtgcagg
gattattatcctcatagcctgggcaggcttttaagttgtgtcaagtggaattgcaaggaa
gatgtggcacagatgcaagtgctgctacaaatatggcctgagatgcaccctgagctggct
ttagaactcttggattgtaactatgctgatcaaaaagttcgagagtttgctgttcgctgt
attgagaaaatgggggatagtgacctgatgcactatatgctgcagttagttcaggttttg
aagtatgaatcataccttgactgtgagcttgccagattcctactgaagcgaacactgaac
aatcagaacctaggacatgagctgttttggttactgcgtgcagagatgcataaccctgag
gtgtctgtgcggtttggacttatgcttgaagcttactgccgtggatcaccagctcacatg
aagagcttacagaaacagcttgaagccctgaacaagatgaagacaatttcgagcttgtta
caacatgtggaccgtgacaagagagctcaagggcttcagacaatgaaagagtgcttacag
cagaagacgtaccaggatgccttatcaaggctgacatctccactcaacccaagctataga
ctcaagcaacttaaggttgacaactgcaagtatatggactccaagatgcgaccactgtgg
ctcgactttgaaaactttgatgagctaggtgaaccagtgaagatcatcttcaagagcgga
gatgatctccgtcaagatatgttgactctacagttgatcagaattatggataggctatgg
aagaaagatgggttggacttggagatgatcccatacgggtgcctgagcacgggtgatcac
gttggcatgatagaggtggtgacgaactccgagaccatcgctaagatccaaatgaagcag
atgggtgctatcaccggagccttcaacaagacttgcatcttggactggcttgcagacagg
aacggctctaaggaagcactggtcgaggcaacacacaggtttatgctgtcctgtgcgggg
tactgtgtggcaacgtatgtcttgggtgtcggagacagacatagcgataatatcatggtc
catgagaacggacagctgttccatatcgatttcggacacttcctcgggaacttcaagaac
aagtttggcattcgaagagagcgtgtcccgtttgtgttgacagaccacttcgtccacgtg
atcactcgtggtaacgacaacaccgagggattccaagagttccgtcgtatttgcgagcag
gcgtttctcgttctgcgcaggcgcggctccctcctcattaacctattcgtgatgatgctc
tcggctggaatccctgagctgcgctcgctggacgacatcggttatctccgcaaaactctc
aacctgaacgtgtccgaggagaaagctttagagtacttcaatagaaagttcaacgaagcg
gtggacaacagctggaagaccagcattaactgggctatccacaacaaggttcgcgacaac
ccttag

DBGET integrated database retrieval system