KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g243879Help
Entry
NEMVE_v1g243879   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NEMVE_v1g243879
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NEMVE_v1g243879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 315 aa AA seqDB search
MSADIDSHITKKYEIKKRLGKGAYGIVWKAIDRRTGEVVAVKKIFDAFRNQTDAQRTFRE
ICFLQEFGDHENVVKLMNVIKADNDKDIYLVFEYMDTDLHNVIKRGNILKDIHKRYIMYQ
LLKATKFIHSGNVIHRDLKPSNLLLDSECFAKICDFGLARSVSNITQEAGDPSLTDYVAT
RGILRAPEILLASPRYTKGVDMWSIGCILGELLLGKPLFPGSSTLNQIEKIMTSIAPPSR
QDVDSIKSHYSTSVLDRMACKPKRSLADVLNTAPSDAIDLLNKLLQFNPDKRLTAEEALS
HPYVARFHNPEEEPA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgatatagacagccatataacgaagaaatatgaaatcaagaaacggcttggc
aaaggagcctacgggattgtctggaaagcgattgatcgaaggactggagaagttgttgcc
gtcaagaaaattttcgacgcgtttaggaatcaaacagatgcccagagaactttcagggag
atttgctttttacaggagtttggggaccatgaaaatgttgtcaaactcatgaatgtcatt
aaagctgacaacgataaagatatctacctagtcttcgagtatatggatactgacctccac
aatgtcattaagaggggaaatatactcaaagacattcacaaacgctatatcatgtaccag
ctattaaaagcaactaaatttattcactctggaaatgtaatccatagggatttgaagcct
agtaacctgctattagactcagaatgttttgccaagatatgtgattttggtttagctcgc
tctgtttccaatatcacacaagaagcaggtgatccaagcctaactgattatgtcgcaaca
agagggatcctcagagctccggaaatcctcttagcttcacccagatacacaaaaggtgta
gacatgtggtccattggatgcatacttggagagctattattaggaaagccactttttcct
ggatcttctacattgaaccagatagagaagataatgacgtctatcgcaccacccagccga
caagatgtagacagcatcaagtctcattatagcacctcagtacttgacagaatggcctgc
aagcccaagcgaagcttggcagatgtcctgaacactgctccttctgatgctatagatcta
ttaaacaaactgctacagttcaatccagacaagaggctgacggctgaggaggccttgtca
catccttatgtcgcaagattccataatccagaggaggaacctgcatag

DBGET integrated database retrieval system