KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g244165Help
Entry
NEMVE_v1g244165   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nve03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nve03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 471 aa AA seqDB search
MAAVDSDKWGCSFFRHLQRKDLYEYLSGLPVGILDRLFCHPATCLTVFRELPELAKHFVM
RTLFADQPVPESIVSTWVKSAYYKYNIGSLNTLKQLRIWREVPSGVHKRYEMNATFRTNM
KAALCGGGKSWMGSTQHLGPDKHTREPDFLDKYAIERWESVLHFMTGSTEMADNAGGVSQ
DVVKVLVLSGLMKCESPGSNPIISPAGFQFLLLDRPSQVWYFMLQCLETVEARGMDLVEC
LSLLFQLSFSSPGKDYPTDGLTDSQMKFLQQLREIGLVFQRKRKSRRYYPTKLSVNLTAA
GKGINTTDSQIEAGFIIIETNYRVYAYTESCLQVSLIGLFCEILCRFPNLCVASLTRESC
QQALASGISAEQILNFLQTRAHPEMLKRTPIIPSTISDQVRLWEMERSRMKFTEGVLYNQ
FLSQADFEMLRKYAEDLGVLIWANSTKRVVVVSRSGHDDVKRFWKRQRQGP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggatagtgataaatggggttgctccttctttcgccatttgcagcgaaag
gatctttatgagtatttatctgggcttccagttgggattctagacagattattttgtcac
ccagcaacttgccttaccgtattcagagagcttcctgaacttgcaaaacactttgtgatg
agaacgttgtttgctgatcagccggtacctgaaagcatagttagtacatgggtgaagagt
gcatattacaagtataacataggttccctgaatacgctgaagcagttgagaatctggcgt
gaggtacctagtggagtgcataagcgatatgagatgaacgcaaccttcaggacaaatatg
aaggctgcattatgtggagggggaaagtcatggatgggctcaacccagcaccttggtcca
gataaacacacaagagagccagatttcttggataaatatgctatcgagagatgggagagt
gttcttcatttcatgacgggctccacagagatggcagacaatgcaggaggtgtcagccaa
gatgttgtgaaagttcttgttttgagtggactcatgaaatgtgagtcccctggctcaaat
cctattatcagtcctgctggcttccagttccttctcttggacagaccctcacaagtctgg
tacttcatgcttcaatgtctagaaacagtggaggccagaggcatggaccttgtagagtgt
ctgtctttgctttttcagctcagcttctcatctcctggaaaggactatcctactgatggg
ctcactgatagccagatgaagtttcttcaacaattaagagaaataggcttagtattccaa
agaaagagaaagtcaaggagatattatcccacaaaattatctgttaatttaacagcagca
gggaaaggaattaatactacagattcacaaatagaagctgggtttattattattgagaca
aactacagagtatatgcatacacagagtcttgccttcaagtgtccctcatcggattgttc
tgtgagatactctgtagattcccaaacttatgtgtggcaagtttaacacgagaaagctgt
cagcaggctctagcaagtggaatttctgcagaacagattctgaattttctgcaaacgcga
gctcaccccgagatgttaaaaagaaccccaattataccatcgaccatcagtgatcaagtc
cgcctgtgggaaatggaacgcagcagaatgaagttcaccgaaggtgtgttatacaaccag
tttctttcacaagcggactttgaaatgctccgcaaatatgccgaggacctcggcgtactc
atctgggcgaactcgaccaaaagagtcgtggtcgtcagtcgctcaggacacgacgacgtc
aagcgattctggaagagacagcggcaaggcccatga

DBGET integrated database retrieval system