KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g246711Help
Entry
NEMVE_v1g246711   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Exosome [BR:nve04147]
 Exosomal proteins
  Proteins found in most exosomes
   NEMVE_v1g246711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 140 aa AA seqDB search
MSWDSYIDNLLAQAKDATGNCHADKACIIGLDGGAPWTSAGHACAVKLQPEECTKIANCF
KNKDFTSFMSSGIHAEGEKYQFLREEDGKLVLGKKKDHGAITIQASKTALVIGHTKEGGQ
QGNTNKAVAVIAEYLESLGM
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagttgggacagctacattgataaccttcttgcccaggcaaaggatgccactggcaac
tgccatgccgacaaagcttgtattattggcctagatggtggtgctccttggacgagtgcc
ggacatgcatgtgcagtcaagttgcaacccgaggaatgtacaaaaatcgcaaactgtttt
aaaaataaagacttcacttcttttatgtccagtggtatacacgctgaaggcgaaaagtac
cagttcttaagagaagaagatggtaaactggtactaggaaagaaaaaggatcacggggcc
atcacaatacaggcgagtaagacagccctcgtgatcggtcacactaaggaagggggtcaa
cagggcaacacaaacaaggctgtcgctgtcatcgctgaatacctcgagtcgttaggcatg
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system