KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g30881Help
Entry
NEMVE_v1g30881    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NEMVE_v1g30881
Protein phosphatases and associated proteins [BR:nve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NEMVE_v1g30881
Ubiquitin system [BR:nve04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NEMVE_v1g30881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 778 aa AA seqDB search
ASIWHALHHYAYSDAVFLAERLFAEVGSDDALHLLASCYYQAGQIKRAYSLLQTNGCPTP
LCRILFAKCCITNLHRLAEGEMVLAGGCLFTNGKPIETIAAEFGTSAGYALSILGQICRK
SDQSKRAAECFKSSLRHNPFLWTSFEALCNLGEKPDEMEYFKSSSCTKILSSLMQRETMT
TGIATSTMATNPAADSQQQPIKCMAENLDPSSNNTPLPIGNFSFDQAGNNTPGSDSGFLI
PPTPMSLISENRVRARVGRNLLGATQTSSPLSPSFGILPCDTPVDQNTVPFITPSPAVLG
GTDMHSGNTPKAPLKKGVRRSDTTSTRSTVVSTVHTTSAPSQILTRASPSHPSVSQSLFP
SSTTNKTVRRSTRLFTMSSNSSGENRVPVSICFLTALANGDKPTRTSITQDSLGEFDVRF
LLSTSLIAEWFKRMLKVILRKAIFDGVSDGLMALLRHIGQAYRQLCGYESREALLLFSTL
PTHHYNTTWVLSQVGRAHFELAEYQLAEKVFSQVQHLDPSRLEGMEIYSTILWHLQKEVE
LSSLAHHLVEVDRSSPEAWCATGNCFSLQKEHDTAIKFFQRAVQVDQACTYAYTLLGHEY
VLTEELDRAMSCYRMAIRSDPRHYNAWYGVGMIYYKQEKFNLAEVHFRKALSINPSSSVL
YCHVGVVQHAMRKSEAALATINKAMLIDPKNPLCKFHRASILFSIDKYQEALHELEDLKK
IVPREALVYFLIGKVYKKLGQAHLAQMNFSWAIDLDPKGANNQIKDAIDKRYLPDDDD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
gcatccatttggcatgcgcttcaccattatgcatattcagatgcagtatttctagcagag
aggttatttgccgaagtgggctcagatgatgctctacatttgcttgcatcttgctactac
caagcagggcagatcaagagagcctactctcttcttcagacaaatggatgccccacacct
ttatgtcgcattctgtttgctaagtgctgcatcacaaatttgcacagacttgctgaggga
gagatggtgctggcaggaggatgtctgtttactaatggcaaaccaatagaaaccatagca
gcagagtttggtacctccgcagggtatgccctgtcaatccttggacaaatatgcaggaaa
tctgatcaaagcaagcgagcagctgaatgcttcaagagcagtttacgacacaatccattc
ctatggacctcatttgaagcactctgcaatttgggtgaaaaacctgatgagatggaatac
tttaagtcttcttcttgcacaaagatattgtcttcacttatgcaacgggaaaccatgaca
acaggcattgcaacaagcaccatggcaacgaacccagcagcagacagtcagcagcagcca
ataaagtgcatggctgaaaatctagacccctccagcaataatacgccactacctatcggg
aatttttcatttgaccaagctggaaataatactccaggaagtgacagtggttttctcata
cctcccacccctatgagtctcattagtgaaaacagagtgagagcccgtgtagggaggaat
ttgcttggagctacacagacttcaagtccattatcgcccagttttgggattttgccctgc
gacactcctgttgaccagaacactgtgcccttcatcacaccgtcaccagctgtgctgggt
ggaactgatatgcattcaggcaatactccaaaggctcctttgaaaaagggtgttagaagg
agtgacacaacatccacaaggtctacagtggtatcgactgtccacaccacctcggcaccc
tcccagatactgaccagagcatcgccctctcaccccagtgtcagtcagtctctttttcca
tcatccaccaccaacaaaacagtgcgccgcagtacccgcctcttcaccatgtcttcaaac
tcaagcggagaaaacagagtccccgtgagcatttgttttttaacagctttggcaaatggg
gacaaaccaaccaggacatccataacacaagatagtttaggtgagtttgatgtaagattt
ttattgagtacctctctaatagcagaatggttcaaacggatgcttaaagtgattctgagg
aaggccatctttgatggtgtttcagatggtctgatggcgttgctgaggcatataggccaa
gcctatcgccagctatgtggctatgagtcaagggaggcacttctgttattttcaaccctt
ccaacccaccactacaatacaacttgggtattgagtcaagttgggcgggctcactttgag
ctagcagaataccaactggctgagaaggtattttcacaagtccagcacttggaccccagc
cgtcttgaaggcatggagatttactccactattctatggcatcttcagaaggaagttgaa
ctctcatctttagctcatcacctggttgaagtggacaggtcatctccagaggcctggtgt
gctactgggaactgcttcagtctccagaaagaacatgacacagccatcaagttcttccaa
cgtgctgtgcaagtcgaccaagcctgtacctatgcctacacactcttaggtcatgagtac
gttctgacggaggagctggatcgggccatgtcctgctacaggatggcaattaggagtgac
cccagacactataatgcatggtatggtgttgggatgatctactacaagcaggagaagttt
aatctggctgaagtacacttcagaaaggcattgtctataaacccgtcaagctctgttctt
tattgccatgtaggagtggtccagcatgcaatgcgtaagtctgaggcagccctcgccacc
atcaacaaggcgatgcttatcgaccccaagaacccactgtgcaagttccaccgtgcatca
atattgttttctatcgacaagtaccaggaggccttgcatgagctcgaagaccttaagaag
atcgtaccgagggaggctttggtctatttccttattggaaaggtctataagaagctcggt
caggctcacctagcacagatgaacttctcttgggccatagacctcgacccgaaaggggcc
aacaaccaaatcaaagacgccatcgacaaacgctatctcccagatgatgacgat

DBGET integrated database retrieval system