KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g31928Help
Entry
NEMVE_v1g31928    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     NEMVE_v1g31928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 276 aa AA seqDB search
MSVNYASGLSDYPNKGKCGLPEVFDSESELASKVSHLAEMIRAAKRVVVHTGAGVSTAAG
IPDFRGPKGVWTLEEKGITPKIDVSFDSAAPTLTHMAIVKLQEEGLVHYVISQNVDGLHL
KSGYPRSKLSELHGNMFVEKCDKCNKEYVRTTAVASVGQKRSGRACTQTRQRGSCRGKLC
DTILDWEHNLPYNDLVNAEKNSREADLALCLGSSLQILPSGNLPVLTIKNGGKLVIVNLQ
RTKHDKKADLKINYYVDDVMKQLMENLELEIPQYTG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttaactacgcgtcagggctgtcggactatcccaacaaaggaaaatgtggctta
ccagaggtttttgactccgagtcggaattagcttccaaggtgtcccatctagccgagatg
attcgagcggccaaacgtgttgtcgttcacactggggccggtgttagcacggctgctgga
atacctgacttcagaggccctaagggcgtgtggacgctagaagagaaagggataacccct
aagatagacgtgtcgtttgatagtgcggccccgactttaactcatatggccatcgtgaag
ctccaagaagagggacttgtccattatgttatcagtcagaacgtagatgggttgcatttg
aaatccggatatccaaggtcaaagttgtcagaacttcatggtaacatgtttgttgagaaa
tgtgataaatgtaataaagagtacgtccggacgactgcagtggcaagtgttggacagaag
cgcagcggacgagcctgcactcagaccagacagcggggttcttgcaggggcaaactatgt
gataccatactggactgggaacataatctgccatataatgacttggttaatgctgaaaaa
aactcaagagaggctgatcttgccttgtgcttgggttcatctcttcaaattttgcccagt
ggtaaccttccagtgctaaccatcaagaatggtggcaagctggtcattgtcaatcttcag
agaacaaaacatgacaaaaaagccgatctcaagatcaactactatgttgacgacgttatg
aaacagttgatggaaaatcttgaactagagattccgcaatacaccggg

DBGET integrated database retrieval system