KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g59503Help
Entry
NEMVE_v1g59503    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NEMVE_v1g59503
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g59503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 5496943
NCBI-ProteinID: XP_001618629
JGI: 59503
UniProt: A7TBS7
AA seq 103 aa AA seqDB search
KRSAKSGKKPEASKGKKNVVAGDKKKRKGRRKESYAIYIYKVLKQVHPDTGISSKAMGIM
NSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLLPGE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
aaaagaagcgcaaaatctggtaagaaacccgaagcatctaaaggcaagaaaaacgtcgta
gctggtgacaaaaagaagcgcaaaggtcgtcgcaaggagagctacgccatctacatttac
aaagttctgaagcaagttcatcccgacacaggaatctccagcaaagcaatgggcatcatg
aattcgttcgtgaacgatatattcgaacgcatcgctgcagagtcgtctcggctagcgcac
tacaacaagaagtccacaatcagctcgcgagagattcagactgcaattcgcctactacta
ccaggggag

DBGET integrated database retrieval system