KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g63622Help
Entry
NEMVE_v1g63622    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nve00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 255 aa AA seqDB search
IAFGSCNKHNVENLLWDDVLNEKPDVWIWGGDIVYADTDNMTKLKKIYDAQNAVKGYQEL
KATVPVIGTWDDHDYGLNDGGIEFKAKKESQQVFLDFMGVAEESPRRQQEGVYAVHDYSL
EEGTVKILVLDTRYFRTALTKDTATRKRFQPNAYGEGTILGAIQWKWLEDQLKNSTADFN
VIVSSIQVFSNEHGYETWGNFPHEVDKLERLLVDSNAKGVLLLSGDRHISEFSKKEVNGL
SYPVIDFTSSGLTHS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
attgcgttcggttcttgtaataagcataatgtagaaaatctcctttgggacgatgtgcta
aacgaaaaaccagatgtatggatttggggaggcgatattgtgtatgctgataccgataat
atgaccaagctaaaaaaaatatatgatgctcaaaatgcagtgaaagggtatcaagaatta
aaagcaacggttcctgtaattggcacatgggacgatcatgattatggtttaaacgatgga
ggaatagaatttaaagccaaaaaagaaagtcagcaagtatttttagattttatgggagtt
gccgaagagagtccgagacgccaacaagaaggggtttacgctgtacacgattattcatta
gaggaaggaacagtaaagattctagttttggatacgcgttattttagaacagccctaaca
aaagatacagcaactagaaaacgattccaacccaatgcctatggtgaaggaaccatttta
ggggcaatccaatggaaatggttagaagatcaattaaaaaatagtacagccgattttaat
gttattgtgagtagtattcaggtgttttctaatgaacatggttatgaaacttggggcaat
tttcctcatgaagtggataaattagaaagattactagtcgattcaaatgctaaaggagtt
cttcttttatcgggtgatcgacatatttcggaattttctaaaaaagaagtgaatggtttg
tcctatcctgtaattgatttcactagtagcggtttgacacattca

DBGET integrated database retrieval system