KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g79092Help
Entry
NEMVE_v1g79092    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    NEMVE_v1g79092
Enzymes [BR:nve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NEMVE_v1g79092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 442 aa AA seqDB search
MAYTSAGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
AMEEITRYHSDDYIKFLKSIRPDNMSDYTKQMQRFNVGEDCPVFDGLYEFCQLSTGGSIA
GAVKLNKQHTDIAINWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGRGKYYAVNFPLRDGIEDESYQQ
IFQPIITKVIEIYQPNAVVLQCGADSLAGDRLGCFNLSLKGHAKCVEFVKSFNLPLLILG
GGGYTIRNVARCWTYETSVALDSDIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPDYL
DKIKQRLFENLRMIPHAPGVQMQPIPEDAFPAESDNEDEEDPNQRISIRASDKRIACEEE
FSDSEDEGEGRRDVRENRPHKR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacatcggctggcggcaagaaaaaagtttgctattattacgatggtgacatc
gggaactactactatggccaagggcatcccatgaaaccgcatcgtattcgtatgacacac
aaccttctgcttaactatggcttgtacagaaagatggagatataccgacctcacaaggct
gcgatggaagaaataaccagatatcactcagatgactacattaaatttcttaaatcaatc
cgtccggacaacatgtccgactatacgaagcagatgcaaagatttaatgttggtgaggat
tgccctgtatttgatggactgtacgagttctgtcaactatcaactggaggttctatagct
ggtgcagtaaagctcaataagcaacacacagatatcgctataaactggtcaggaggcctg
catcacgccaagaagtctgaggcttctggcttctgttatgtgaacgatattgtgctggct
atcttagaactgctcaagtatcaccagcgtgtgctgtacatagacatagacattcatcat
ggcgatggggtggaggaggcgttctacaccactgacagggttatgacagtatctttccac
aagtacggcgagtatttcccagggacgggagacttgagggatattggagcagggcgtgga
aagtactatgccgtcaactttcctcttcgagatgggattgaagacgagtcgtaccaacaa
atctttcaacctattatcactaaagtgatagagatctatcaaccaaatgctgtagttctg
cagtgtggtgctgactccctggctggcgacaggcttggctgcttcaatctctccctcaaa
ggccatgcaaagtgtgttgaatttgtcaagagcttcaacctgccgttactcatcctcggt
ggtggcggttacaccatcagaaatgttgctcgttgctggacctacgagacatcagtggcc
ctggactcggatattgccaacgagttgccatacaacgactactttgagtacttcggtcct
gactttaagctacacatcagtccgtcaaacatgaccaatcagaacacacccgattacctg
gataaaatcaagcaaagactgtttgagaatctgaggatgattccacatgctcctggtgtt
cagatgcaacctattcctgaagatgcctttccagcagagagtgacaatgaagatgaagaa
gacccaaatcagaggataagcatccgagcctctgacaaaagaattgcttgtgaagaggag
ttctcagattctgaggacgaaggtgagggtcgtcgggatgtccgggaaaacaggccacac
aaacga

DBGET integrated database retrieval system