KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g81388Help
Entry
NEMVE_v1g81388    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NEMVE_v1g81388
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NEMVE_v1g81388
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NEMVE_v1g81388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 130 aa AA seqDB search
GPCSLVIFGFPCNQFGFQEPGANADEIRNSLKYVRPGNGFVPNFPLMNKTEVNGINQNPV
YTFLKVCMRCPCSDGVIQADRDKVIWSPVRSGDITWNFEKFLIDHHGKPVRRYKPWVHPV
ELGQDIERLI
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ggtccttgtagcctggttatcttcgggttcccatgtaatcagttcggttttcaagaacct
ggtgcaaatgctgacgagatcagaaacagtctgaaatatgtcaggcctgggaacgggttt
gtgccgaactttccgctcatgaacaaaacggaagtgaatggaattaaccagaatcctgtc
tacacttttctcaaggtatgtatgagatgcccctgctctgatggtgtgatccaggctgat
cgcgataaagtaatctggtctcctgtcaggagcggtgatatcacttggaactttgagaaa
ttcctcatcgaccatcacgggaagcctgtgcgtcgctacaaaccgtgggttcaccccgtg
gaactggggcaagatatcgaacggctgatc

DBGET integrated database retrieval system