KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g81508Help
Entry
NEMVE_v1g81508    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00480  Glutathione metabolism
nve00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NEMVE_v1g81508
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NEMVE_v1g81508
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NEMVE_v1g81508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Ribosomal_S27
Motif
Other DBs
NCBI-GeneID: 5521416
NCBI-ProteinID: XP_001641323
JGI: 81508
UniProt: A7RGZ3
AA seq 149 aa AA seqDB search
GLTKAQYPQLNALAVNYGKVEDVCSLKVFGFPCNQFGKQEPGDNADEIRNSLRFVRPGNG
FVPKFPLMNRTDVNGNKQHPAYTFLKAQCPSPDGMIMGNHDDIIWSPVKSGDISWNFEKF
LIDHHGKPVLRFKPSVNPKDLGQEIERLI
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ggccttactaaggcgcagtaccctcaactgaatgcattagccgtgaactacggtaaagtt
gaagatgtatgtagccttaaagtgtttgggttcccttgtaatcaatttggcaagcaagaa
cccggggataatgctgatgaaatcagaaacagtctgaggtttgtcagaccgggtaatgga
tttgtaccgaagttcccacttatgaataggacagacgtgaacggaaacaaacaacatcca
gcatacacttttctaaaggcccagtgcccctcccctgacgggatgatcatgggtaaccac
gatgacatcatctggtcgcctgtcaagagcggcgacatcagctggaactttgagaaattc
ctcatcgaccatcacgggaagcctgtgctccgatttaaaccgagcgtcaacccaaaagac
ctggggcaagaaattgaaaggctgatc

DBGET integrated database retrieval system