KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g83566Help
Entry
NEMVE_v1g83566    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 554 aa AA seqDB search
MEPRTARVLVLYTGGTIGMEKTQSGYQPKTGFLQKQIKRLPMLYDEDFMATRKNQQQTQS
ESLELEELAMPVSPYNVRVLYYIKEYVPIKDSSNLMIEDWVMMALDIQKHYDSYNGFVVI
HGTDTMAYTASALSFMMENLGKTIVLTGSQVPIYEQRNDGRDNLLGALMIAGHYIIPEVG
LYFGGCLYRGNRATKVDAGSFSAFDSPNLPPLVTMTVKIDVQWDAIFRCNNTTSFTVHTK
MNPNIGLLRLFPGITAMTVKSFLQPPMQGVVLQTYGAGNAPNNRSDLINEIKQATDRGVI
IVNCTQCIHGPVVDAYATGRTLIDAGVVPGSDMTPEAALTKLSYVLGHDHLTVKERQELM
RRNLRGELKVAQSQEQFSLKDSEFIEAVACSLHIGSSEEMRYIRRALLPVLMCCASSSGS
VQTLQKLLDQGADPNGNINYDGRTPLHIACLNGNLEIARFLLQHGASVHVRDRFNRSPLE
DAIKFRHQKVVELLVETGATLGRSTSEIAAEVCCLAAKNRVDDLRLWGTASADLNGVDYD
GRTPLHVVSTMPRR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggagccgagaacagcccgcgttctcgtcttgtataccggtggaactatcggtatggaa
aagacacaatccggatatcaaccgaagaccggttttctccaaaaacagattaaacgcctt
cccatgctttacgacgaagacttcatggctactaggaagaaccaacaacagacacaatcc
gaaagtttggagctagaagaacttgctatgccggtgtctccatataatgttcgagtgcta
tactacattaaagagtatgttccgatcaaggattcatcaaacctgatgatcgaagactgg
gttatgatggcgcttgacattcagaagcactatgatagctacaatggatttgtagttatt
catggcaccgatacaatggcttatactgcctcagccctctcttttatgatggaaaatctt
gggaagacaatcgttttaactgggtcacaggtcccaatttatgaacagcgaaatgatggc
cgggacaacctcctaggtgccctgatgatagcaggccattacattatccctgaagttggt
ctctactttggtggttgtctttatagaggcaacagagctactaaggttgatgctggaagt
ttcagtgcctttgactctccaaacctccctccgttggtaacaatgacagtcaaaattgat
gtgcaatgggatgcaattttcagatgtaacaataccacaagcttcactgttcacacaaaa
atgaatcccaatattggtctgcttaggctctttcctggaattactgccatgactgttaag
tcatttttgcagccacctatgcaaggagttgtgctgcaaacttatggtgccggaaatgcc
ccaaacaatcgcagtgacctgatcaatgagattaaacaggcaaccgacagaggtgttatt
attgtgaactgtactcaatgtatccacgggccagtagtggatgcctacgctacaggaagg
actctgattgatgccggtgtggtccccggctctgacatgaccccagaggccgcccttacc
aagctatcctatgttctaggtcatgatcaccttacagttaaagagcggcaagagttgatg
agacggaacttgcgaggtgagctgaaggtggcacaatcgcaggagcagttttccctgaaa
gacagcgagttcattgaagcggttgcctgctcccttcacataggctcaagtgaggaaatg
agatacattcgtcgggcgcttttaccagttcttatgtgctgcgcttcaagttccgggagt
gttcaaacccttcagaaactgctggaccagggcgctgatcctaacggtaatatcaactac
gatggtcgcacgcctctgcatatcgcctgcttgaacggcaacctagagatagcgcgtttt
ctactgcagcacggcgcgtctgtccacgtgagagaccgctttaacagaagtccgctggag
gacgcgatcaagttcaggcatcaaaaggttgttgagctactggtggagactggggccact
ttgggccgaagcacgtctgaaatagcggccgaagtgtgctgcctggcagcaaaaaaccga
gtcgacgatctacgcttatggggtaccgcgtccgctgacctgaacggtgttgactacgac
gggcgcacgccgttacacgtggtgagtacaatgcctagaaggtga

DBGET integrated database retrieval system