KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g83596Help
Entry
NEMVE_v1g83596    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
nve  Nematostella vectensis (sea anemone)
Module
nve_M00688  MAPK (JNK) signaling
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NEMVE_v1g83596
Protein kinases [BR:nve01001]
 Serine/threonine kinases: STE group
  STE7 family
   NEMVE_v1g83596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 5520533
NCBI-ProteinID: XP_001640471
JGI: 83596
UniProt: A7RJN6
AA seq 307 aa AA seqDB search
MYEYSSSDLVDCGEIGRGAYGTVNKMLHPNSNTFMAVKRIRSTVDQKDQKQLLMDLDVVM
RSSNCPFIVRFYGALFTEGDAWICMELMEISFDKCYKLVYGSIEQIIPEEILSKVAYAVV
KALDYLKRELNIIHRDVKPSNILLDRNGAIKLCDFGISGHLVDSIAKTRDAGCKPYMAPE
RIDPSSCRQGYDIRSDVWSFGITMIELSTGVFPYPKWNSVFDQLSQVVDGDPPQLSNTPE
MMRSPELLNFVNICLSKEVEKRPKYNELLNHQFIQLYQERPVDVGAWLQEVLALAPEDPD
FTEHYQQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtactcttctagtgacctagttgactgtggtgagattgggcgtggtgcttac
ggcacagttaacaagatgctacaccccaacagcaatacgtttatggcagtcaagagaatt
cgctcaacagttgaccagaaagatcagaagcaattattaatggacctggatgttgttatg
agaagtagtaactgcccatttattgtcagattttatggtgcactttttactgagggtgat
gcatggatctgcatggaactgatggaaatttcatttgacaaatgctacaagttggtgtat
ggttctatagaacagattattccagaagaaattcttagcaaagtggcttatgcggttgtc
aaagccctggattacttaaaaagagagcttaacattattcatagagatgtgaagccgtca
aacattcttcttgatcgaaatggtgccatcaagttgtgtgactttgggatcagtgggcat
cttgttgattccatagctaagactcgagatgcaggatgcaaaccttatatggctcctgaa
agaatagacccatcgtcatgccggcaaggttatgacatccgctcagatgtgtggagtttt
gggataacaatgatagagttgtctactggtgtcttcccgtaccccaagtggaatagcgtg
tttgaccagttatcacaagttgtcgatggggaccccccacagctgtccaacacccctgag
atgatgaggtcacctgagctattaaatttcgtcaatatctgcttatctaaagaagttgaa
aagaggcccaagtataacgagctattgaaccaccaatttatccagctttaccaagagcgc
cccgtagacgtaggggcgtggctgcaggaggttctggcgctggcgcccgaagacccagac
ttcacagagcactaccaacagtag

DBGET integrated database retrieval system