KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g84846Help
Entry
NEMVE_v1g84846    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:nve04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1320 aa AA seqDB search
MISVDEVEPEEGQLEEDEGEIVDWQLPLCFMKKRHKEPIAGAELLAQTWRMKERMKTVSV
ALVLCLNVGVDPPDIVKTSPCARLECWIDPLSVTPHKALETVGNKLQEQYERWQPRARYK
QSLDPTVEEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKSYTQYIPLSVY
DLQTWMGSPSIFVYDCNNAGLILQSFNTFASQREQEHEVSTTRCLTQGTPMPVPLAVKNC
IQLAACAANQLLPMNPELPADLFTSCLTTPIKVALRWFCSQNSSKIVPGMTLELIEKIPG
RLNDRRTPLGELNWIFTAVTDTIAWNMLPRELFHKLFRQDLLVASLFRNFLLAERVLRSF
NCTPVSSPQLPPTYMHPMWHAWDLAVDLCLLQLPEVIENPANFKNSAFFSQQLTAFQVWL
AMGSEMRDPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVNLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQSDLVKDNGHKYFLSVLADPYMPAEHRTMAAFVLS
AIINGFPSGQEACLQGNLIAICLEQLTDPHPLLRQWLAVCLAKVWASYDAARWCGVRDTA
PEKLYCLLSDPLPEVRAAAVYALGTFIANTGDRSDHANQIDFGVAMTLTQLGHDGSPLVR
KELVVSLHGLVIQFETNFGVVALQFLDEDRQKENAPPAAAITSTGWIVVGSGSSGTPTTP
EPQTPVRKLSRGLRTSLSSSQLSHQTNSPAGLMHYSSSSSSSSSSDFFAAKELRRTPSTS
SLSSSFQSNVYANTWKALLNLSVDPDRSVCDKAKKIVNNITLKATISANPQKVTGTNIRS
QSTSAPSSPSGRYTNPFPHQREQNSPPVHHRSHQSISQPTTPSRGEAPRMGGAQGNPGIY
HPHSYEFHVKRKVFGKGPDVNEVDSDDETSPMKPQIIRTNFAEWCASYFAQSVMKPPEEH
DPQSQLHLQREWRFERNSRVRREAARQQARADVCKLDDQIFINKNIHPPGILRFHPYEPH
LAVADRGGVSIWNWEQGARMNYFNNNNSKLTRITSMEFLNAHDLTLLLTGTDDGSVRVWR
DYDGVESPVEVVTAWQALSGMLPSTRGSGSGLVVNWEQETGILLASGDVRFIRVWDTQRE
MKMQDIPTGADSCVTSLACDSVGRSLLIAGCGDGSVRLYDRRLPPSDSRVMALREHTGWV
TSVFLQKGGDGNIISGSVAGDVRFWDPRFTESVKGFDTLNNMTSFEVHQQAKVLASGSAN
QIIKVMDLDGGMRSVIRYHDGFMGQRIGPVSCMEFHPHRVHLAAGSTDSFISIYSTEKKR
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgatatctgtagacgaggttgagccggaggaagggcagttagaggaagatgagggtgaa
atagtcgactggcaacttcccttgtgtttcatgaaaaagaggcacaaggaaccgatagct
ggcgctgaacttcttgcacagacatggcgaatgaaagaaaggatgaaaaccgtcagtgtt
gcgctagtactgtgtctcaatgttggggttgatccgcccgatattgtgaagacgagtccc
tgtgcgcgcctcgaatgttggatagaccctctgtctgtgaccccacacaaagctcttgag
accgtgggcaataaactccaagagcagtatgagagatggcagccgagggcacgctacaaa
cagagtcttgacccaacagttgaggaagtcaagaaactctgtacttctctacggagaaat
gctaaggaagagagagtcctcttccattacaatggtcatggggtgccaagaccaactgtt
aatggagaaatctgggtctttaataagagctatacccagtacatcccactgtcagtttat
gacctacaaacatggatggggagcccttccatatttgtctacgactgtaataatgcagga
cttatcctacagtccttcaacacatttgcaagtcagcgtgagcaagaacacgaggtttct
acaaccagatgtttgactcaaggcacgcccatgcctgtgccgctagctgttaagaactgc
atccagcttgcagcttgtgcagccaatcagctgttaccaatgaaccctgagcttcctgcc
gatctgttcacctcatgtctgaccacacccatcaaagttgccttgagatggttttgcagc
caaaacagcagcaagattgtcccggggatgaccttagaattaatagaaaaaataccaggt
agactgaatgacaggcgaacaccacttggtgaactgaactggatatttactgcagtgaca
gataccattgcctggaatatgcttccaagagagttatttcacaagctgtttagacaagac
ctcttggttgctagtttgttcaggaatttcctgttggctgagagagttctgcgctccttc
aactgcactccagtatccagtccgcaactgccaccaacctatatgcacccaatgtggcat
gcatgggatctggctgtagatctttgtcttttgcaactaccagaagtcatagaaaaccca
gccaattttaaaaacagtgcctttttctcccaacaactgacagcatttcaagtgtggctt
gcgatgggttcagagatgcgcgaccccccggagcagttgccaatagttctgcaagttctt
cttagtcaggtccatagacttcgggctcttgaccttttgggtcgtttcctggaccttggg
ccatgggctgtcaatttggccctgtctgtagggatattcccatatgtgcttaagctacta
cagagttccgcacgagaacttagacccctattagtcttcatctgggcaaagattcttgca
gttgacagctcatgccaatctgaccttgtgaaggataatggccacaaatacttcttgtcc
gtcttggctgacccttacatgccggctgagcatcgcaccatggcagccttcgtcctctcg
gccatcatcaatggcttccccagcggccaagaggcatgtctccaaggcaacctcattgcc
atctgtctagaacagctgacagaccctcatccactcttgcgccagtggctggctgtctgt
ctggcaaaggtttgggcaagttatgatgcagccaggtggtgcggggtgcgggacacagca
ccagagaagctctattgcctgctgtctgaccctcttcctgaggttagagcagctgcggtg
tatgctctaggaacattcattgccaacacaggggacaggtcagaccatgccaatcagatt
gactttggcgttgccatgacactcacgcagcttggtcatgatggtagtcccttagtcaga
aaggaacttgtcgtatccctacatggacttgtcatacagtttgaaactaactttggggta
gtcgccctgcaatttttggatgaggatcgacaaaaagagaatgctccacctgccgcagcc
atcacatccacagggtggatagtggtggggtctggttcgtcaggaacacccaccacaccc
gaaccccagacccctgtcaggaagctgtcacgtggtctacggaccagcctttcatcctca
cagcttagtcaccaaaccaactctcctgcaggccttatgcattacagcagtagtagcagt
agctccagcagctctgatttctttgctgctaaagaacttcgacgaacaccttcaacctcc
tcgctatcctcatcttttcagtctaatgtatatgccaatacatggaaggccctccttaac
ttgtctgtagacccagaccgctcggtctgtgacaaagccaaaaagattgtcaacaatata
acactcaaggccactatcagtgctaacccacaaaaggtcaccggtacaaacattcgctca
cagtcaacgtctgcaccctcatcacctagcggccgctacactaacccgtttccgcatcag
agagaacagaactcgcccccagtgcaccacaggagtcaccaaagcatctcccagcccacg
actccctcaagaggtgaagcaccccgcatggggggtgcccaggggaatcctggtatttat
catccacactcatacgagttccatgtcaaaaggaaggtgtttggcaaaggacccgatgta
aatgaagttgattctgacgatgaaacgtcgccaatgaagcctcagatcattagaacaaac
tttgctgagtggtgtgccagttactttgcacagtcagtcatgaagccgcccgaagaacac
gacccccagagccagcttcatcttcagagggaatggcggtttgagcggaactcgcgagtg
cggcgagaagctgcaagacaacaagcaagggcagacgtgtgcaagctggatgaccagatc
ttcatcaataagaacatccacccccctggtatactacggtttcatccctacgagcctcac
ctggctgtggcagacagggggggagtcagtatttggaattgggaacagggagcacggatg
aattattttaacaacaacaacagcaagctaacaagaattactagcatggagttcctcaac
gctcatgacttgaccctactgctgactggaacagacgatggttctgtccgtgtctggcgt
gactatgatggcgtcgagtccccagttgaggtggttaccgcctggcaagcgttgtctggg
atgttaccctctacgcgcggtagcggctctggtctcgtcgtcaattgggaacaggaaact
gggattttactcgcgtcgggcgacgttaggtttatacgtgtgtgggacacgcagcgagag
atgaaaatgcaggacatcccgacgggtgcagacagctgcgtgacaagccttgcctgtgat
tctgtcggacgctcgctactaattgctggctgtggtgatgggtctgtccggttatatgac
cgtcggcttcctccgtcggacagccgggtgatggcgctacgagagcacacaggctgggtg
acaagcgtctttctacagaaaggtggagacggcaacattataagcggcagcgtcgctggc
gacgtgcgcttctgggacccacggttcaccgagtcagtcaaaggtttcgatactctgaat
aacatgacctcattcgaggtccatcaacaagcaaaggtcctagccagtggctcagccaat
cagatcatcaaggtgatggacctagacggaggcatgcgcagtgtgatccgttaccacgac
gggttcatgggtcagcggattggcccagtcagctgcatggagttccatcctcacagggtt
caccttgcggccggaagcactgattccttcatttcgatctactcgacggagaaaaagaga
tga

DBGET integrated database retrieval system