KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g89249Help
Entry
NEMVE_v1g89249    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NEMVE_v1g89249
   00330 Arginine and proline metabolism
    NEMVE_v1g89249
Enzymes [BR:nve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     NEMVE_v1g89249
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 222 aa AA seqDB search
IYSKGEDCKPEWKDAEANFDEKNDHLQIMGKPVMERWETPYMHKLASIAASNGGRVLEIG
FGLAISATKIQSFPIDEHVIIECNDGVFKRLEKFAENAAHKVTPKKGLWEDVVPTLEDNS
FDGILYDTYPLMTCQKSHIRKKMYVGGGGIKSIIPGNISSGKSYLKYKYPVKRYQETQIS
HLVESGFAVNDISTEVMDIDCEEGCKYYSHNKMIAPTIKKAK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atttacagcaagggagaagattgtaagccagaatggaaagatgcagaagcaaatttcgac
gagaaaaacgatcatttgcaaattatgggtaaaccggtaatggagcgatgggagacgcca
tacatgcacaaactcgcttctatagcggcatctaacggcggcagagttcttgaaattggc
tttggattagcgatctcggctaccaagatacagagttttcctattgacgagcatgttatc
attgagtgtaacgatggagttttcaagcgacttgaaaagtttgctgagaacgcagctcac
aaagtcaccccgaaaaaaggtctctgggaagatgttgtccccactcttgaagataactcc
tttgatggcatcttgtatgacacctaccccctcatgacgtgtcaaaaaagtcacatccgt
aaaaaaatgtatgttgggggtggggggattaaaagcataatacccggtaacatttcatcg
ggtaaaagttatttaaaatataaatacccggtaaagcgttatcaggaaacacagatcagc
catcttgttgaaagtgggtttgctgtgaatgatatatccactgaagtcatggatatagac
tgtgaagaaggctgtaaatactatagccataacaagatgattgcgcctactattaaaaaa
gctaagtaa

DBGET integrated database retrieval system