KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g89529Help
Entry
NEMVE_v1g89529    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    NEMVE_v1g89529
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     NEMVE_v1g89529
Glycosyltransferases [BR:nve01003]
 Glycan extension
  Type 3 chain
   NEMVE_v1g89529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 268 aa AA seqDB search
IDFDVDLNDTHHKQSNKAKSLLKKVRVLCWVMTSPTNLPVKGKPVKETWGKRCDVLLFMS
SKEDKSFPAVGLDVPEGHGKLWFKTRAAWQYVIDHHMDDADWFLKADDDTYVIVENLKYL
CSKYDPDKPHFFGRKFKMFGGYHSGGAGYVFSKETLRRFAKLLKDEKRCPLESFAEDVEV
GRCLAKEGVSPGDTRDSRMRETFHPFPPEHHLIPGFLPKDFWYHQYNAWPIKDGTPECCA
DHAITFHYISPNMMYQMEYFVYHLRPYG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atcgacttcgatgtagatttgaatgatacccatcacaaacagagcaacaaagccaagagt
ttattgaaaaaggtccgggttttatgctgggtaatgactagccctaccaatctacctgtt
aaaggaaaacctgtgaaggaaacatggggaaaaagatgtgatgtcttgttgtttatgagc
tcaaaagaggataaaagcttcccagcggtggggcttgatgtcccagagggtcatggcaag
ttgtggttcaagactcgtgctgcatggcaatatgtgattgaccatcatatggacgatgcg
gattggtttctcaaggcggatgatgacacttatgtcatagttgaaaacctcaagtatttg
tgttcaaaatacgaccctgataaaccacacttctttggacgcaagtttaagatgtttgga
ggatatcatagtggtggtgcaggttatgtctttagcaaggagactttgcgtagatttgca
aagcttctgaaagatgagaaacgctgtcctttggagagttttgctgaagatgtggaggtt
gggagatgtcttgcgaaggagggtgtttcacctggtgatacgagagactccagaatgcgt
gagacttttcatccatttccccctgagcaccacttaattcctggatttcttccaaaagat
ttttggtatcaccaatataatgcctggccaataaaggatggtacgcctgagtgctgtgcc
gatcatgccataacattccattatatctcaccaaacatgatgtatcaaatggaatatttt
gtgtaccatctaaggccatatggg

DBGET integrated database retrieval system