KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g9075Help
Entry
NEMVE_v1g9075     CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 63 aa AA seqDB search
RKGRRKESYAIYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKST
ITS
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
agaaagggaagacgtaaggaaagctatgctatctacatctacaaggtgctgaagcaagtc
caccccgacaccggtatctcgagcaaggccatgggcatcatgaactctttcgtgaacgac
atcttcgagcgcatcgctggtgaagcttcccgcctggcgcactacaacaagaagtccacc
atcacgagc

DBGET integrated database retrieval system