KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g91949Help
Entry
NEMVE_v1g91949    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    NEMVE_v1g91949
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    NEMVE_v1g91949
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NEMVE_v1g91949
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NEMVE_v1g91949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 357 aa AA seqDB search
VEEVRKKLDDLNLDEIQRRRLEEFLNEKRKIGELSNDDFEKITELGAGNGGVVTKVLHKP
TGLIMARKLIHLEVKPAIRTQIIRELKVLHDCNSPYIVGFFGAFYSDGEISICMEHMDGG
SLDLILKKAGRIPEDILGKISIAVLKGLCYLREIHQIIHRDVKPSNILVNSRGEIKMCDF
GVSGQLIDSMANSFVGTRSYMSPERLQGNQYTIQSDIWSFGLSLVEMAIGRYPIPPPDPQ
EIEKVLSREPSSMASPMSVGRLPPGVRPPSGVNNETRPMAIFELLDYIVNEPPPILPGAH
FSPEFCEFVQKCLVKNPKQRADLTYLMTHKFIAKADKSNVDFAKWISQFLSEDSNSQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtagaggaagttcgcaaaaaattggacgatcttaatttggacgaaatacagcgaagacgc
ctggaagaatttttgaacgagaaacgaaaaatcggtgaactgagtaatgatgatttcgag
aaaatcactgaacttggagcaggcaacggtggtgttgttacgaaagtgttgcacaaacca
acaggcctgataatggcaagaaagttgatccatctagaggtcaaacccgccattagaacg
caaattatccgagagttgaaggtcctacatgactgcaattccccttacattgttggattt
tttggagccttctacagcgatggagaaatttcgatatgcatggagcacatggatggaggc
tcacttgatctgatactcaagaaggctggaaggattcctgaagacattttaggcaaaatt
agcatcgctgtgttaaaaggtctttgttacctgagagaaatccaccagattatccataga
gatgttaagccatccaacatcctagtgaactcaagaggagagattaaaatgtgtgacttt
ggtgtcagtggacagttgatagattcaatggcgaactcctttgttgggacaaggtcctat
atgtcgccagagcggttacaagggaatcaatataccatccaatcagatatctggagcttt
gggctctcgcttgtcgagatggcgataggacgctatccaataccgccgccagacccacag
gagatagaaaaagtcttgagtagggaaccctctagtatggcctcgcccatgtctgtgggc
cgcctcccgcctggtgtaaggccccccagtggtgtaaataatgagacaagacctatggca
atatttgaactgttggactacatagtaaacgagcctcctccaattcttcctggtgcacat
ttctcaccagaattttgtgaatttgttcaaaagtgtcttgtcaaaaatcccaagcagaga
gcagaccttacttatcttatgactcacaagtttattgctaaagcggacaagtccaacgtt
gactttgccaaatggatatctcaattcctatcagaggacagcaactcacagtaa

DBGET integrated database retrieval system