KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g92099Help
Entry
NEMVE_v1g92099    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K16172  
insulin receptor substrate 1
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    NEMVE_v1g92099
   04150 mTOR signaling pathway
    NEMVE_v1g92099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 194 aa AA seqDB search
LKKRYFVLRPISPTGKARLEYYENDKKFRAHSPPKRVIELSSCFSIAQKDDTKHKFVFVL
YTREDVFGLIAESHHELTQWMDALLDEKEKNEAAPERVLQPEWNIVIKPRGLGTSKNLAG
SCKLQLTNEAIRLISKAPGNPVTELQLNCIRRCGHTDCFFYMELGRSAATGAGEIWVQVE
DPLLAQNMHEAILG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaagatatttcgtccttcgaccaatatctcctacaggcaaggcaagattggaa
tactacgagaacgacaagaaatttcgcgcgcatagcccaccaaagcgtgtcattgaattg
tcaagttgttttagcatcgctcaaaaagatgacactaagcacaagtttgtgttcgtccta
tacacgcgcgaggacgtgtttgggctgatagccgaatcacaccacgaactgactcaatgg
atggacgcgcttctcgacgagaaagaaaaaaacgaagctgcgccggagagagttcttcag
cccgaatggaacattgtcataaagcctcggggcctaggtaccagtaagaacctggccgga
tcttgcaagttacagctgacaaatgaagccattcggctgatcagtaaagcccctggcaac
cctgtgacagagctgcagctgaattgcatcagacgctgtggacacacagactgctttttc
tacatggagcttggccgttcagcagcaacaggtgcaggggagatatgggttcaagttgaa
gatccgcttctggctcagaacatgcatgaggcgattttggggtag

DBGET integrated database retrieval system