KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g92099Help
Entry
NEMVE_v1g92099    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K16172  insulin receptor substrate 1
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04068  FoxO signaling pathway
nve04140  Autophagy - animal
nve04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    NEMVE_v1g92099
   04150 mTOR signaling pathway
    NEMVE_v1g92099
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    NEMVE_v1g92099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_8 PH_9
Motif
Other DBs
NCBI-GeneID: 5517532
NCBI-ProteinID: XP_001637580
JGI: 92099
UniProt: A7RST3
AA seq 194 aa AA seqDB search
LKKRYFVLRPISPTGKARLEYYENDKKFRAHSPPKRVIELSSCFSIAQKDDTKHKFVFVL
YTREDVFGLIAESHHELTQWMDALLDEKEKNEAAPERVLQPEWNIVIKPRGLGTSKNLAG
SCKLQLTNEAIRLISKAPGNPVTELQLNCIRRCGHTDCFFYMELGRSAATGAGEIWVQVE
DPLLAQNMHEAILG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaagatatttcgtccttcgaccaatatctcctacaggcaaggcaagattggaa
tactacgagaacgacaagaaatttcgcgcgcatagcccaccaaagcgtgtcattgaattg
tcaagttgttttagcatcgctcaaaaagatgacactaagcacaagtttgtgttcgtccta
tacacgcgcgaggacgtgtttgggctgatagccgaatcacaccacgaactgactcaatgg
atggacgcgcttctcgacgagaaagaaaaaaacgaagctgcgccggagagagttcttcag
cccgaatggaacattgtcataaagcctcggggcctaggtaccagtaagaacctggccgga
tcttgcaagttacagctgacaaatgaagccattcggctgatcagtaaagcccctggcaac
cctgtgacagagctgcagctgaattgcatcagacgctgtggacacacagactgctttttc
tacatggagcttggccgttcagcagcaacaggtgcaggggagatatgggttcaagttgaa
gatccgcttctggctcagaacatgcatgaggcgattttggggtag

DBGET integrated database retrieval system