KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g92175Help
Entry
NEMVE_v1g92175    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nve04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:nve04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:nve04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 345 aa AA seqDB search
MFYTAQVGDTIFIVLKRYQNLQPIGSGAQGMVCAAIDTVTGEKVAIKKLSRPFQNVTHAK
RAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIHMDLDHERL
SYLLYQMLCGVKHLHDADIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFMMTPYVVT
RYYRAPEVILGMGYCDNVDVWSIGCILAEMIRGHVMFPGTDHIDQWNKVTEQLGTPSESF
LNQLQPSVRMYCTRRPKQPGFSFEALFPDDLFPPENKLKANPTYTLIKPMYVTTQISQPY
LSINQTYVRYDPNKPARPKHLSNLCTKYDHSIDEQEHSVEEWKSK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttttacactgcccaagttggagacacaatttttattgtgttgaaaaggtatcagaat
cttcaacccatcggatcgggtgcacaaggaatggtgtgtgctgccatagatacggtcact
ggggaaaaggttgctatcaagaaactcagccgaccatttcagaatgtcacacatgccaag
agagcctttagagaacttgtgctcatgagaatggtcaaccacaaaaatatcattggtttg
ctaaatgtctttaccccagaccggacgctagaacagttcaacgacctatatctcgtgatg
gagttgatggatgcaagcttgtgccaggtaatccacatggatctagaccatgagcgactc
tcgtatcttctctaccagatgctttgtggggttaagcacctccatgatgccgatatcatc
cacagggatctaaagccaagtaatatagtggtcaagtcagattgctctcttaagatcctg
gactttggtttagcaagaactgctggctctgcttttatgatgaccccatatgtggtgacg
cggtattacagagcgccagaagtcatactcggcatggggtactgtgacaatgttgacgtc
tggtctatagggtgcatactggcagagatgatcagaggacatgtcatgtttcctggaaca
gatcacattgatcaatggaacaaggtgacagaacagcttggcacgccatcagaatccttc
ctcaaccagcttcagccctcagtacggatgtactgcaccagaagacccaagcagcctggc
ttttcgtttgaggccttgttcccagatgatttatttcccccagagaacaaattaaaagcc
aaccctacttatacattaatcaaacctatgtacgttacgacccaaataagccaaccctac
ctaagcattaatcaaacctatgtacgttacgacccaaataagccagcccgacccaagcat
ttatcaaacctatgtacgaaatacgatcattccattgacgagcaagagcactctgtcgag
gaatggaaaagtaagtga

DBGET integrated database retrieval system