KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g96946Help
Entry
NEMVE_v1g96946    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:nve04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 755 aa AA seqDB search
MNPSEFSRPVNLQRIAQRKAQVKTYPRRKKLEKLGVYSSCKVEDTCKCNGWKNPNPPPTP
PRLDLSQPLASLNDPCRSCGHSLGLHISQLQSISEDELDRLLCMVVDVENLFMCVHKEED
ADTKQVYFYLFKLLRKCILQMSTPTVEGQLGTPPFEKPSIAKAVINFVLHKFGHLPQREW
QIMHDLAKMFLHCLNHWKLETVAMRKQHAEAEHIAAYKLNYTRWLCYCHVPVFCDSLPKC
DTTAVFGRTLLRSVFSVMRSQLLEKFRAEKDKMPADKRTIVLTHFPRFLSMLEKEVYGES
SPIWDDDFTVPQSLMAARASSTPVVTINAESGESQTGCVAVHFYFLPKKYNVNQKFEESL
GIVKSLTFITDSDVPLDVLKQVVETISDPSAMIGPESGLYPGAHSARDEHARCEERRGVI
EFHVVGNSLRRMPSRLTQQWLVGLQNVFSYQLPRMPKEYITRLVFDPKHKTLALVKDNRP
IGGICFRMFPTQNFTEIVFCAITSNEQVKGYGTHLMNHLKDYHIKHGVLNLLTYADEYAI
GYFKKQGFSKEIKIPKASYTGYIKEYEGATLMHCQVNSCIQYTEFSTIIRKQKEIVKKLM
SRKQEQIRRVYPGLTCFKEGVRQIPVESIPGISETGWRSSMNKSVTKEADPSVLQTQLKN
ILTQVKNHASAWPFQKPVERAEAPDYYEHIKYPMDLKTMTERLKSGYYSSKKLFVADMRR
IFQNCRTYNSPDTEYYKCANTVERFFLSKIKEPGK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcagagtttagccgaccggtaaatctacagagaatagctcaaagaaaggct
caagtcaagacatatccgcgtcgaaagaaactggaaaaactaggggtctattccagctgc
aaagtagaggatacttgcaaatgtaatggatggaagaaccccaaccccccacccacccct
ccccggctagacctgtctcaaccgctggccagcctgaatgacccgtgtcgcagctgtgga
cactctctgggactccacatttcccaactgcaaagcatatctgaggatgaacttgacagg
ttactctgtatggtggtggatgttgagaacttgttcatgtgtgttcacaaggaagaggac
gcggacacaaagcaagtttacttctacctgttcaagcttttacgaaagtgcattttacaa
atgtcaacgcccactgttgagggccagcttggcacacctccatttgaaaagccaagtatt
gccaaggctgttataaattttgtccttcacaagtttggccacttgcctcagcgggaatgg
caaataatgcatgatttggccaaaatgtttcttcactgtttaaaccactggaaattagag
acagtagcgatgcgaaagcagcatgcagaggctgagcacattgccgcatataaactaaac
tacacaagatggctttgttactgtcatgtgccagtcttttgtgatagcctcccaaagtgt
gacacaacagcagtgtttgggaggaccctcttgagatctgtgttctcagtaatgaggagt
caactcttggagaagtttagagctgagaaggacaaaatgcctgcagacaagaggactatt
gtgctcactcattttccaaggtttttatccatgcttgaaaaggaagtttatggtgagagt
tctccaatttgggatgatgactttacagttccacagtctttgatggcagccagagcatct
tcaacacctgttgtcactatcaatgctgaaagtggggaatcacaaactgggtgtgttgct
gttcatttttactttttaccaaaaaaatataatgttaatcagaaattcgaggaatctttg
gggattgtaaaatctttaacatttattacagatagtgatgtacctcttgatgtcctaaag
caagttgtggagacaataagtgacccttcggctatgataggtccagagagtggcttatac
ccgggagcccatagtgcacgtgatgagcatgcgcgctgcgaggagagacgaggcgttatt
gagtttcatgttgttggcaactcccttcggcggatgccttctcgtctgacccaacaatgg
ctggttggtttgcagaatgtcttctcatatcagctcccgcgcatgcccaaagaatacatc
acaagacttgtgtttgacccgaaacacaagacgttagctcttgtcaaggacaatcgtccg
attggtggaatttgttttcggatgtttcccacacaaaacttcactgagattgtattctgt
gccatcacttcaaacgaacaagtcaagggttacggcacacacctcatgaatcacctgaag
gactatcatatcaaacacggcgtactgaatctgctaacctacgctgacgaatatgccatc
ggctacttcaagaagcagggctttagcaaagagatcaagatccccaaggcctcatacacg
ggttacattaaggagtacgaaggcgccacactcatgcactgtcaggtcaacagctgtatt
caatacaccgagttctccaccataatacgaaaacagaaagagatcgtcaagaaactgatg
agccgaaagcaggagcagatccgtcgcgtgtacccagggctgacgtgcttcaaagaggga
gtccgacagatcccagtcgagagtattcctggaataagtgagactggctggcgatcgagt
atgaataaaagcgtcaccaaagaagcagatccatcagttttacaaacgcaactcaagaac
atcctgacgcaagtcaagaatcatgccagtgcctggccgtttcagaagcctgttgaacgc
gcggaagctccagactattacgaacacatcaagtaccccatggatttaaagacgatgaca
gagcgccttaaaagtggctattacagttctaagaagctcttcgtagcagacatgcgcaga
atcttccagaactgtcgcacatacaactcgcccgatacggagtattacaagtgcgcgaac
actgttgaacggttcttccttagcaagataaaggagccgggaaaatga

DBGET integrated database retrieval system