KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g98698Help
Entry
NEMVE_v1g98698    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NEMVE_v1g98698
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NEMVE_v1g98698
    2.7.1.82  ethanolamine kinase
     NEMVE_v1g98698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 351 aa AA seqDB search
QAHKLCGEYLGGSWSEVSLNEFGFKVLTGGLSNEIFICNLPEHFAENKQEVRKVLFRIYG
RLVGKLISNIHSLVAENVVFALLAEKKIAPKLYAIFPEGRLEEFLQAKSLTVAEIRSAEN
SVKIARKLREFHGLSLPLGKNPKWFWERCERYNAYAYTTPNKYNKLWSLLCTSHLSACFI
CYRNIAESKAGPILFCHQDIQEGNILSVPRDVDNEGQQQYDLLFIDYEYCGYNYRGFDLA
NHFNEWMWDYKHEEAPYYLYNPELFPSLEQQLLFIRTYLGEQTNCHSQDKISPKEQELLD
EVQRFALVSNFFWGMWSVVQAKMSNIEFGYLEYAFTRFDSYRRQKKKLGLE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
caggcccataaactttgtggtgaatatcttggaggaagctggagtgaagtgtctctgaat
gaatttggttttaaagtgctcactggtggcctctccaatgagattttcatctgtaacctt
ccagaacacttcgctgagaataaacaagaagttcgcaaagttctgtttagaatatatgga
agattggttggaaaactaataagtaacatccattctttagtagcagagaatgttgtgttt
gctctccttgctgagaaaaagattgcacctaaactttatgctatttttcccgaaggacgg
cttgaagaatttttacaagcaaaatctttaactgtagctgagataagatctgcagaaaat
tctgttaagattgcaagaaagttgagggaatttcatggtctgagtttaccactggggaaa
aatcctaagtggttttgggaaagatgtgaaaggtacaatgcatatgcatatacaacccct
aacaaatacaataagttgtggtcgcttctctgcacatcacatttatctgcttgttttatt
tgttatagaaatatagcagagtctaaagcaggacccatcctcttttgccaccaagacatc
caggaaggtaatattctgtctgtgccaagagacgtggataatgagggacagcagcagtat
gacttgctatttattgactatgagtactgtgggtacaactacagaggctttgatctcgct
aaccattttaatgaatggatgtgggactacaaacacgaagaggcgccctactacttgtat
aatcccgagctatttccctctttagaacagcagttgctattcataagaacgtatctagga
gagcagacgaattgccacagccaggataagatatcgcctaaagaacaagagttacttgat
gaagtacaaagatttgctttggtatcgaactttttctggggcatgtggtcagtagttcaa
gcaaagatgtcgaacattgaatttggatatcttgaatacgctttcacaagattcgactca
tacagaagacaaaagaaaaaacttggtttggaataa

DBGET integrated database retrieval system