KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g99284Help
Entry
NEMVE_v1g99284    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NEMVE_v1g99284
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     NEMVE_v1g99284
Glycosyltransferases [BR:nve01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NEMVE_v1g99284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 565 aa AA seqDB search
MSLCNLLAFAAIVFLTVATRYYSITEPDWVCWDETHFGKHANFYIKGEFFFDVHPPLAKM
LIALSGYLTGYNGTFPFDKPGDLYGENNYLGMRLLCVTMGSLCVPLAYLIVWELTKSTAA
SLLASSMILFDNGCVTISQYILLDPILMFYIMLSAFCLTKFQSCKNSFNTPSWWFWMFAT
GVSLACAFSCKWVGLFVILWAGITTVMDLWELLGDLSLSLFEISKQFIARVLGLIILPIM
VYLFWFSVHFKMLPNTGPGDGFFSSAFQSTLKGNPLYMASVPEDLAFGSMITLKNHRAGG
ALLHSHHHLYPKEHAPEQQQVTGYSHKDDNNKFLIKKAYEDYDANEPVEFVKNGDWIRLE
HAATKRNIHSHNEKAPLTKHHMQVTAYGEEGKGDANDFWRVEIVSGSPDNHVKTVRTIFR
LIHVNLDCALHMGSKTLPKWGWEQLEVTCNPVQHELGNMWNVEGHDNDRIPKASPELFKP
SFFASVYESHIVMAQTNSGFKPKEGEVTSLPWQWPINYRGQVFSGADHRVYLLGNPVVWW
FVLAVMALFAALYGFHAVRVQRGYK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctgtaatcttcttgcgttcgctgctattgtttttctgacggtggctacaaga
tactactccataactgaacctgactgggtttgctgggatgaaacacactttgggaagcat
gctaacttctatatcaagggggaattcttttttgatgtccaccctcccctggctaagatg
cttatagcactgtctggttatctgactggatacaatggtacatttccatttgacaagcca
ggggacctttacggggagaataattatcttggcatgcgactgctatgtgtcacaatgggc
tccctgtgcgttcctctggcatacttgatagtatgggaattgaccaagtccacagcggcc
tcattactggcttcttctatgatactttttgataatggttgtgtgacgatatcccagtac
atcttgctggatcctattctgatgttctatatcatgttgtctgcattttgtcttacaaag
ttccaatcttgcaaaaatagttttaatactcccagctggtggttctggatgttcgctact
ggcgtctcattagcctgcgcctttagctgtaagtgggttggcctgtttgtgatcctttgg
gcaggaatcaccacggtgatggatctatgggaattgctgggcgacctgagcttgtcactg
tttgagatatccaagcagttcattgctagagtccttggtctgatcatactccccatcatg
gtttatctgttctggttttcagtacacttcaagatgttaccaaacactggccccggtgat
ggattttttagttccgccttccagtccactctaaaaggaaaccctctgtacatggcgtct
gtccctgaagatctcgcatttggttcaatgattacacttaagaatcaccgggcaggcgga
gccttactgcactcgcatcaccatctctacccaaaagagcatgctccagaacagcaacag
gtcacaggttactcgcataaagacgacaacaacaagttcctgataaagaaagcttatgaa
gactatgatgccaatgaacccgtcgagtttgtcaagaatggggattggatcagactggaa
catgctgcaaccaaacggaatatccacagccacaatgagaaggcccctctcacaaaacac
cacatgcaagtgacagcttacggcgaggaaggtaaaggtgacgctaatgacttctggcgt
gtggagatagtcagtgggtcaccggataatcatgtcaagacagtccggactattttcaga
cttattcacgtcaacttggactgtgcacttcacatgggatccaagacactaccgaaatgg
ggctgggagcaactggaggttacatgcaaccctgttcaacacgagctgggtaacatgtgg
aacgtggaaggccatgataacgaccgaatccccaaggcaagtcctgagttgttcaaaccg
tcctttttcgccagcgtctacgagtcgcacatcgtaatggcacagaccaactcgggattc
aagcccaaagaaggcgaagttacgtcgctgccttggcagtggccaatcaactatcgggga
caagttttttcgggtgcggaccaccgggtctatctccttgggaaccctgtggtgtggtgg
tttgtactagctgtgatggcattgttcgccgcactctatggtttccatgctgtacgcgtg
cagaggggatacaag

DBGET integrated database retrieval system