KEGG   Nasonia vitripennis (jewel wasp): 100113502Help
Entry
100113502         CDS       T01081                                 

Definition
nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100113502
Messenger RNA biogenesis [BR:nvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100113502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 1706 aa AA seqDB search
MTGEKSNTEDMWTPYKELQSLVEGYVTSSPSKLDPQFYEFTETLRNHRQNFLSLLKNPPK
NVKSREEILKGETEGITSPGLGHQLLTKELIDETLIISDMYDLNEFMALDLLFTAQLQMP
HHPGLTRGLTAILLYYDGRKALTATLKTLVQARAGHSWMLDIPLALTKQITEYTNRMQED
GLLDRILFLLEEMDPTKEQDLLQQNRALGGAKHHYMVMKLYNDTRQDLADILYMWSAQST
LPTTVMFRLLSFLQKCHPESEAGEGSPDKVTLALIMALSNSINLSPLHSREDGEDIVRSM
PLIAERGVFEELVQKLITQSVAWETAGLRGFIQFVLAIAVTTIKSAPNLCPNQNITKEDE
MLIEAALSNKAFHFAAEVLFKSKYLHFEEFYVRYFHTLISDFILLMPLKVKELRSRADES
MRLIQAYQQEGIEPPVNLDNHFKFLMLMVAELYKFDPLNLNLAMDYWCQHLEPSHLPNSI
HANRLPSRQVALFKFIRLAGEILPAGLFVPYLNMIASLASSVQAARQAFNFLKPNGSTGS
TTISWDHFFNSLNRYYYNLRQELPPTQDTVYRQRGHPKGITPSEVKGLEAVLLVVQIVAK
YDEMSRMALCDHPGWKVLQSLIGLVSCAMPIPLKGVLVKTLAALAKSPDSSSTIWQNLEA
AQIITTIPTTSSYQPRGVQTELEEIESRNEEYPLTRAMLELLDVLTDFPIPRLLGVGQRN
PGFDPYLNFIINTVFLRFNTRSYKNPSEKWEVADACLKILFKLLKQYEPAVEDFVGCKVE
LQGGEMTVVNASPGYHIMTQLHSNTELLRVILYILDEGCSYLDTYDSFAGKKYLEDSTLN
CLEMLEYSLKTQHQYMSQLAAISSANRISTGVSRLLLGVNHRTGKPDHMINIAKYILYNN
WLRRHAYVAVGVIQGVSNEPGADSELLSTYTSSVSLSTNIRHGFVECLDTEDTGYENEEE
GERNKQQSGHCKDRILLLLMQSITRPAPNLAHYLLGFEITKDIKKTIIQQPGILGYPRTC
LHSILGILELSLEKGRDKITEACYWFLHTLTSNNKTSIPVLRFLRTATNQDFVQRHLSKL
PFQGANRATDLTCMSWLLKIAAIELRVGSGSLQNCLIQRLVGNLGQDRDQVVPSQKLLMD
LLHYIDFQLQLESPKSWEYFDPSQVEMVLGRCSVPIALSGGPMLIDIKKLHSLITDELSV
TQGSATATQRKLMQQELQSILAYALKRNQTKTLSYATVKFVEGWCQTTEILFSIASNQQL
PAAQRQNFLLNLSHDLLQKMTSCEALNEIKTLVSGTVLILLVNLRISFAFQSDDELLPSS
PTNTTMMKIILNHILQWILNSEASSQKVRTHLYGALLYFLCVVGTEKSGENMGAGIETTF
VSQLDNSLYKALPMQERSHRYTTIQVINSFGDKLMDIICHSCSGGHDVCKMLGLSCLNKI
LELDCDNSWVIYLSSRGYLKHMIDGLLESDNLLRCMLQPDPQTLRPLYLYEAKMAMFIRM
AATRLGAESLLENKVLSCLSSMSVVDQHPDVHDSFNGIDPSFLPSVGQRYQQIFLPMLYL
CDALLTTLGTENQSCAIQICGFLQSHRDTVEMTLRNILPSSNTLFMIEVATLTGVIARSA
NIDMYKLVDEEVEKSNIGESNLRDSSGMRELRAHLYRLQRLMLSLLPKFRPLTKEDSNQQ
NFSSVQIAANIMLYVRNQMQHSHMDQ
NT seq 5118 nt NT seq  +upstreamnt  +downstreamnt
atgacgggagaaaaaagtaatacagaggatatgtggactccttataaggaattgcagagt
cttgtagaaggctacgtcacatcatccccaagtaaattagatccacagttttatgagttt
acagaaactctgcgtaatcatagacaaaattttttgtcactgttaaaaaatcctccaaaa
aatgtcaaaagtcgtgaggaaattttaaaaggtgaaacagaaggcattacctcaccagga
ttgggccatcaattactaactaaagaattaattgacgagacattaattataagtgatatg
tatgatttaaatgaatttatggcacttgatttgctatttactgcgcaattacaaatgcca
catcatccaggattgactagaggattaacggctattttattgtattatgatggaagaaag
gctctgacagcaacattaaaaactttagtgcaagctagagctggtcacagttggatgttg
gacataccattggcattgacaaaacaaattacagagtatactaaccgaatgcaagaagat
ggattgttagatagaattttgttcttacttgaagaaatggacccaacaaaagaacaagat
cttttacaacagaatagagcactaggtggtgctaaacatcattacatggtcatgaaatta
tacaatgatacgaggcaagatttggctgatattctttacatgtggtcggcacaatctact
ttaccaaccacagtgatgtttcgactcttatcatttttacaaaaatgccatccagaatca
gaagctggagagggcagtccagataaagttacattagctcttattatggctctttcaaat
tcaataaacttgagtcccttgcatagtcgtgaggatggtgaagatattgttcgttcaatg
ccattaatagctgagaggggagtctttgaagaattagttcagaaattgataacgcaaagt
gtagcatgggaaactgcaggactaagaggttttatacagtttgttcttgcaatagctgtg
acgacaatcaaatcagctccaaatctttgtcctaatcaaaatataacaaaagaagatgaa
atgctgattgaagctgctttatctaacaaagcatttcattttgcagctgaagtacttttt
aaaagcaaatatttgcattttgaagaattttatgttcgttattttcatacattaatatca
gatttcatcttattaatgccattaaaagtgaaagaattgaggagcagagctgatgaatcg
atgcgtttgattcaggcttatcaacaggaaggaatcgaaccaccagtaaatttagataat
cattttaaatttttaatgcttatggtggctgaattgtataagtttgatccattgaatttg
aatttagcaatggattattggtgccaacacctagaaccttcacatttaccaaattctata
catgctaatcgtttaccatcaagacaagtagcattatttaaatttataagattagctggt
gaaattctacctgctggattgtttgttccttaccttaatatgattgcttcacttgcttca
tctgtgcaagctgctagacaagcttttaactttctcaaacctaatggatctactggttca
acaacgatttcctgggatcatttttttaattcactaaatcgttattactataatctaagg
caagaattaccaccaacacaggatacagtttataggcaacggggtcatccaaaagggatt
actcccagtgaagtcaaaggcttagaagcagtgctactagttgtgcaaattgtggcaaag
tatgatgaaatgtctagaatggcattgtgtgatcatcctgggtggaaagttctgcaatct
cttataggactggttagctgcgccatgccaattcctctaaaaggggtgttggtcaaaact
ttggcagctcttgctaagtctccagatagttcttcaacaatttggcaaaatttggaagct
gctcaaattattacaacaataccaacaacaagtagttatcaacctagaggagttcaaact
gaattagaagaaatagaatcgcggaacgaagaatatccattgacgcgggctatgttagag
ttattggatgttttaacagattttccaatacctagactactcggtgttggtcaaaggaat
cctggatttgatccttatttaaattttatcattaatacagtttttctccgatttaatact
cgttcttataaaaatcccagtgaaaaatgggaagtggcagatgcctgtctaaaaatactg
tttaaactgcttaaacaatatgaacctgccgtggaagattttgttgggtgtaaagtggaa
cttcaaggaggtgaaatgactgtagtcaatgcttcacctggatatcatataatgacacag
cttcattcaaatacagaactactaagagtaatcttgtacatactcgatgaaggttgctcg
tatcttgatacttacgattcatttgcaggcaaaaaatatttggaagatagtactttgaat
tgtttagagatgttagaatatagcttgaaaactcagcatcaatacatgtcacagttagct
gcaatttcatctgccaatagaatatctactggtgtatcccgtcttttgttaggtgttaat
catcgcacgggaaaacctgatcatatgattaacattgctaaatatattttgtataacaac
tggttgcgacgtcacgcgtatgtagcggtcggtgtcattcaaggtgtgtccaatgaacct
ggtgctgattctgaattgctttcaacatacacgtctagtgtatcactaagtacaaatatt
aggcatggatttgttgaatgcttggatactgaagacactggatatgagaatgaagaggaa
ggtgagagaaataagcagcaatctggacattgcaaagaccgaatcttgttattactgatg
caaagtattactcgcccagctccaaatctggctcattatttacttggatttgaaatcaca
aaagacataaaaaaaacaataattcaacagccaggaattcttggttatccaaggacgtgc
ttacactcaattttaggaattctagagctgtcactggaaaaaggcagggataaaataaca
gaagcttgttattggtttcttcatacgctaacatcaaataataaaacgtctattcccgtc
ctacgattcctacgaaccgcaaccaatcaagattttgtacagagacacttatctaaattg
ccatttcaaggagcaaaccgagctactgatttgacttgtatgtcttggctccttaaaatt
gctgcaatcgaattgcgtgttggaagcggaagtttgcaaaattgtcttattcaaagactt
gttggaaacctaggacaagacagagatcaagttgtaccttcacagaagttactaatggat
ttattgcattacatagactttcagttgcagctagaatctccaaagtcttgggagtatttt
gacccttcacaagttgagatggtgttaggtcgttgtagcgtgccaatagctctttctggt
ggacctatgttgattgatataaagaaattgcattctcttataactgatgagctatctgta
actcagggaagtgctactgccactcaaagaaaactcatgcaacaggaattgcaatccatt
ttggcatatgccttaaagagaaaccagacaaaaacactttcctatgcaactgttaaattt
gtagaaggatggtgtcaaacaactgaaatattgttttctattgcatcaaatcagcagctt
ccagcagctcaaaggcaaaattttcttctaaatctttctcatgatttactgcaaaaaatg
acatcatgcgaagctctcaatgaaatcaagacattagtttctggaacagttttgatactt
ttagtaaatttaagaattagttttgcttttcaatcagatgacgaactactcccttcttcg
ccaacaaatacgactatgatgaaaataattctgaaccatattcttcaatggattctgaat
tctgaagcttcctctcagaaggttcgcactcatctttatggggctcttctttacttcctt
tgtgttgttggtactgagaaatcaggagagaacatgggagctggtatagagacaacgttt
gttagtcagttggataattcattatacaaagcacttccaatgcaagaacgctcacatcga
tataccacgattcaagtgattaatagcttcggcgataaattaatggatataatttgtcat
agttgttcaggtggccacgatgtttgtaaaatgcttggcctgtcttgcttaaacaaaatt
ctagaattagattgtgataattcatgggttatttacttatctagccgaggatacttaaag
catatgatagatggtttattggaatcagataatttattgcgttgcatgcttcaaccagat
ccacagactttaagacctttgtatttgtatgaagccaaaatggcaatgttcataagaatg
gctgcaacaagacttggtgctgaaagtctcttggaaaacaaagttttatcttgtctttct
agtatgtctgttgttgatcaacatcctgatgttcatgatagtttcaatggaattgatcct
tctttcttaccttctgttggccaaagatatcaacaaatatttttgcctatgctgtattta
tgtgatgctctactcactacacttggtacagaaaatcagtcgtgtgcaatacaaatttgt
ggatttttgcagagccatagagatacagttgaaatgaccttaagaaatattttaccgagc
tcgaatactctattcatgattgaagttgctactttaactggagtaatcgcaagatctgca
aatattgatatgtacaagttggttgatgaagaagttgaaaaatctaatattggcgaatct
aatttgagagacagtagtggcatgagagaattgcgggcccacctttatagacttcaaaga
ttaatgctttctcttttaccaaagttccgacccttaaccaaagaagattcaaatcaacaa
aacttttcatcagtccaaatcgccgctaatatcatgttgtatgtcagaaatcaaatgcaa
cacagccatatggatcag

DBGET integrated database retrieval system