KEGG   Nasonia vitripennis (jewel wasp): 100113538Help
Entry
100113538         CDS       T01081                                 

Definition
acyl-protein thioesterase 2
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100113538
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100113538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
3
AA seq 230 aa AA seqDB search
MGNSQVRKKKQTAMTSPVVIAATARHTATLIFFHGLGDTGHGWASSLGSLRAPHVKVICP
TAPTMPVTLNAGFRMPSWFDLRSLDASGPEDEEGIRRAAETVHSMIAQEVAAGIPTERIV
LGGFSQGGALALFSALTFPQPLAGVVALSTWLPLHQKFPAEAVGNKNIPVLQCHGDCDPI
VPYKWGQATATLLKQFMTNTEFKTYRGVMHASCDEELRDIKDFIEKLLKP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggcaattcacaagtacgaaaaaagaagcagacagctatgacgagtcccgtggtgatc
gcagccaccgcaaggcatacggccacgttaatttttttccatggactcggtgacacagga
catggatgggctagttccttgggttccttgagggcgccgcatgttaaagttatttgtcca
actgctccaacaatgcctgttactttgaacgcaggatttaggatgccatcctggtttgat
ctgagatcattagatgcaagtggaccagaagatgaagaaggtataagaagggctgctgaa
actgtacattccatgattgcacaagaagttgcagctggaattcctacagaaaggattgtt
cttggaggttttagtcaaggcggagcattagctctctttagtgctcttacatttcctcaa
ccattagctggagttgtagcattatcaacttggcttccattgcatcaaaaatttccagca
gaagctgtaggcaataaaaatatacctgttctacagtgtcatggtgactgtgatcccatt
gtcccatacaaatggggtcaagccactgcaactttacttaaacaattcatgactaacacc
gagtttaaaacttaccgaggagtgatgcatgcatcgtgtgacgaggaattgcgcgacata
aaggattttattgagaaattgttgaaaccttaa

DBGET integrated database retrieval system