KEGG   Nasonia vitripennis (jewel wasp): 100113582Help
Entry
100113582         CDS       T01081                                 

Definition
NAD-dependent protein deacetylase Sirt6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100113582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 403 aa AA seqDB search
MSCTYADGLSPYEDKGVLGLEEKFDTDETLRLKCELLADWIKGARHVVVHTGAGISTSAG
IPDFRGPNGVWTLEQKGLKPDSSTSFDEAIPTKTHMALKKLIDTNKVKFIISQNIDGLHL
RSGVPRQYLAELHGNMFVEQCDKCGRQFIRNFATKSVGKKCLETVCRSEQIGGRPCRGKM
HDTILDWEHNLPDNDLALADLHSSVADLSVCLGTTLQIIPSGNLPLYTKKYGGRLVICNL
QPTKHDKKADLIINGKLDDVIESVMKKLGLEIPEYESSLDPTRNTDINSREMDWTIPTSR
IKEMKILYKKVCTPVKRKRRATFMYEREQITTKYTPKRKEKKQEFTVKKEEIDHGSTFSN
ATFSNLNNEESNASKVPKVEPLNDDSNEATTCIDAPTEESNVT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcacctacgctgacggtctgtcgccgtacgaggacaaaggcgtcttgggcctc
gaagagaaatttgacacggatgagacactgagactcaagtgcgagctactggcagactgg
atcaaaggggctcgacatgtagttgttcacactggtgctggaatcagcacctcagctggg
attcctgattttcgcggcccaaatggagtgtggaccttggaacagaagggtttaaagcct
gattcaagtacatcgttcgatgaggcaattcctacaaaaacacatatggccctaaagaag
ctgattgatactaacaaagtcaaatttattataagtcaaaacatagatggtctacatctt
cgttcaggagtcccaagacaatatttggcagaattgcacggaaatatgtttgtggagcag
tgtgataaatgtggaaggcaatttattagaaatttcgctaccaaaagtgttggtaagaag
tgtttagaaactgtctgcagatctgaacaaattggtggtaggccttgcagaggaaaaatg
cacgatactattctagattgggaacacaatttaccggacaatgatctggcattggctgat
cttcattcaagtgttgctgatctgagtgtgtgtttagggacaacactacaaattattcca
agtggaaatttgcctctttacacaaaaaaatacggtggacgtttagttatatgtaatctt
caaccaactaaacatgataagaaagcagatttgatcatcaatggtaaactggatgatgtt
attgagagtgtcatgaaaaaattgggattagagattccagagtatgaaagctcgctagat
cctacgcgaaacactgacataaactcgcgtgagatggattggacgatacctactagtaga
atcaaagaaatgaaaatattgtacaaaaaggtttgtacgccggttaaacgaaagcgcagg
gccacgttcatgtatgaacgtgaacaaataacaacaaagtacacgcctaaacgcaaggaa
aagaaacaagaattcacagtgaagaaggaagaaattgatcatggttctaccttcagtaac
gctaccttcagcaacttgaacaacgaagaaagcaacgcaagtaaagtaccaaaagtggag
ccattgaacgacgattccaacgaggctacaacgtgcatagatgctccaactgaggaaagt
aacgttacgtag

DBGET integrated database retrieval system