KEGG   Nasonia vitripennis (jewel wasp): 100113652Help
Entry
100113652         CDS       T01081                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100113652
Enzymes [BR:nvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100113652
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C44
   100113652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 560 aa AA seqDB search
MCGLWALFGLDTNSLTCVCDNFSKISHRGPDAFKIEHDSRVKNAYLGFHRLSIVDGLCGM
QPIRVFKYPLLFLLCNGEIYNYKSLSKEYGFEYSTKCDIEVLMHLYATKGADGVCKSLDG
VFAFCLLDIEKRKILLGRDPYGVRPLFRVVTANGQLAVSSESKALTGIANLLTGDHVVEP
FLPGTFEEYDLLEDGHVKFIRRERYHEPGQKPSFTTFVPWNELSSKDIHENIRKLFSAAV
EKRLMADRRIGCMLSGGLDSSLVAALLVKYAKQHNLPYKIQSFSIGMEGSPDILAARQVA
DHIGTEHHEIIITQKDITDVLEKVIYYTETFDITTIRASIGMYLISRYIKNNTETTVIFS
GEGADELAQGYIYFRDAPSAFDGHKESLRLLKDIYLYDGLRADRTTSAFSLELRVPFLDL
QWTNYYLSLDPSLRQPQNGVEKHLLRSAFDGTGLLPANILWRGKEAFSDGVTSVKKSLFQ
IIDEIVQERVQDEDLQAAYEKYPHCTPKTKEAYYYRKVFESHYGGYAESLIPYYWMPQWV
KGVTDPSARFISHYENKNKV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggactgtgggctctatttggtctcgacaccaattccctcacctgcgtctgcgac
aacttttccaagatttcgcacagaggaccggacgcttttaagatcgagcacgacagtcgg
gtcaagaatgcttacctgggattccacaggctgtcgattgtcgatggactgtgcggaatg
caacctatcagggtgttcaagtatcccctgctgttcctgttgtgtaacggagagatttac
aactacaaaagtttgagcaaggagtacggttttgaatactcaacgaaatgtgatatcgag
gtactcatgcatctgtacgccaccaagggtgccgatggtgtctgtaagtctctggatggt
gtgtttgcattctgcctgttggacattgaaaagaggaaaattttacttggcagagatcca
tatggtgtcaggcctctttttagagtggtcactgctaatggccaattggctgtgtcttct
gaaagtaaagcattgacaggaatcgcaaacctcttgacaggagatcatgtggtagaacca
ttcctaccaggaacgtttgaagaatatgatcttttagaggatggtcatgtcaagtttatc
aggagggagaggtaccatgagcctggacagaaaccaagcttcactacctttgttccctgg
aatgagctgagttcaaaagatattcacgagaatatcagaaaattattctcagctgctgtg
gaaaaacgtttgatggccgatagaagaataggatgcatgttgtcaggaggcttggattcc
agtttagtggctgccttgcttgtaaaatatgccaaacagcacaacttgccatacaaaatt
cagagcttctccattggtatggagggcagtccagatattctggcagcaagacaggtcgct
gatcacattggcactgaacatcacgagataattatcacgcaaaaggatataacagatgta
ctagagaaagttatttattacactgaaacttttgacattactaccatcagagcttccatt
ggaatgtacctaatttcgagatacatcaaaaacaacacagaaaccacagtaatcttcagt
ggtgagggtgctgatgaattggcacagggctatatttacttcagagatgcaccaagtgcg
tttgacggtcacaaagaatctctaagactgctaaaagatatttacttgtacgacggactt
cgtgccgatcggacaaccagtgcatttagtctagaattgagagtaccatttttggacttg
caatggactaactactatctatcgcttgacccgtctctgcgacaaccacaaaacggtgtg
gagaaacatttactcagatctgcatttgatggaactggtttgctgccagcaaacattctg
tggagaggcaaagaggcatttagcgacggcgtgacaagcgtaaaaaagagcctgttccaa
ataatcgacgaaatcgttcaagaaagagttcaagacgaggatctacaagctgcctatgaa
aaatacccgcattgcacaccaaagacaaaagaagcatactattacaggaaagtttttgaa
tcccattacggcggatacgcggaatctctaattccatactattggatgcctcagtgggtc
aaaggcgtgacggatccttcggctcgcttcatctctcactacgagaacaagaacaaagtg
taa

DBGET integrated database retrieval system