KEGG   Nasonia vitripennis (jewel wasp): 100113977Help
Entry
100113977         CDS       T01081                                 

Definition
(RefSeq) filamin-A
  KO
K04437  
filamin
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Cytoskeleton proteins [BR:nvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100113977
  Intermediate filaments
   Intermediate filament-binding proteins
    100113977
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100113977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 2089 aa AA seqDB search
MVGGSARRDSWDAIAKTKSLLSSNSLESLANLANDSLTIDNTKSTTTNNVNEQITENYTQ
NSSSNYSSLKKFSSSEYNYSPKVNNDSLSNSRGILKNKVHSTLGLDTTDTMGRSAAAESS
ATTTTTSTTTTMKTIQEKQQYLNSDSSFLRNSFGHDKLVSGSALEMLAIHRPTSFILDSS
LEASKIAVIVTGPNGRPVPVQKSTLQGQTYTVTADQVGEHTIQILYNGKHIKGSPFRSQA
YNSKAIQVGSIPNGVVNEPVEFEIDGSRAGSGNLEILVNGGHVTSFVRTLSSQRFLASFV
PHEAVTHLVEMTFNGESVPGSPWKVGIMPSPKMSVVGDSVRLVPAGSPAVFELSALGFSS
NEIQVQILTPSKRQIGARIDEEPSRTGEFRVSFTPQEVGSHLVEVSIAGQKLPAGPLVAK
VYNSSLIQVTEVPSAVVGHACQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSF
TPEAAKPHYIDIKFNGEPVPGCPFVCHVSDTSRVSLELAHLELLPVSEPASFHMAVDGSG
SAELAVSVRGPSSELPVKVTGDIHTGFTAEFTPREVGVHAVSVEYNGHPVNGTPFLAKAF
DAERVVIGPVGRASVGQAQHFNVDASQAGEGNLEITISARGQNIPTQVTPQGNARFSVGF
VPFEACEHMINIAFNKRTVPGCPIIARVAPDAHVTVSGQALSSAPLGRQSALTLSNVAGS
LEDLEVNVEGPNGQAVPAQVTDNKDTTCTVAFTPRIVGEHRISVSHRNLPVLGSPFSCKV
YDVSAIKVKDAKKGVIGLPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGPHTYAISFT
PREPTIHTVDLRFNGEDVPGSPFTCQVTDTAKVIVTEALEKVSVNRVASFVIEADSTPTV
DVLAPTRESLPVEIEQIGSGSYSAGFTPKDVGDHSVQVKLNGAHLQGSPFLVKAYNADQV
KVTDINSGVVGKPVFFSINASQAGAGNLEIIVAVNGKNVPNFVQSEGNAKFRVNFKPQEA
ALHSLSVRFNGEPVPGSPFTCQVLGAGQALISGHNLKMAAVKQPISFTIDPQASSSKCDV
IVTPPSNIALPITIEPQDLKYKITFTPTEVGRHNVSVLVDGESIKGSPFACNVYDVTKIH
VSGLSEAFLGQATTFTVDAAQAGEGTLELVVSTENNTVKAEVVACARGLYDVTFVPQTSS
THYVNISFNDDNVPGSPFKCPVIGSILDGPSMIRVGNTAFMDLDMVGLSGPITAEVTGPD
GIIIPCNMTKIDSNLHRVEIKTRNVGTYNVVFSQGSKIISSQSLQAFDPTKVVIQEVSDA
VCHRPGTIFVVAPKEAGPGKLTVSVRSGGAEVDSLVREKDNGIYEIIFHPTRTAPHRVHI
KYNDVYIQGSPLEVAVRGPTGGREVTATGLGLYQSCIGKVTSFSIETLGRPGKEFDVVIS
SPQGNAVPVRCYQHRDGNLLAEFTTNSVGTYKIDVLHGAKPVLGSPFFCQAFDASKIKLQ
ELGPTTVSVHDHFALKIIKAEAGVAELDVAATSPLGQELAMQVRPLNDGAEMIEFSPSVA
GSYVINVSYGGCTVPGSPVVVVAEAAGQARAKGQGLIQGHVGKPAHFLVTGSRSPPAVQV
DGPDSVAKPTVEAGPNPGTWNVSYVPTEPGLFDVRVVCAGQQLPGSPWHPRIIDTRNLRV
IGGWSALCDELGRLKIAPGNKISFDTSEAGPGELSGRIDDQPLKFEMTTNNRLKLIIPQL
AAGEHGMEILFNAVPFPGAPKLAIAPELESSMSQDTSRVMLRGRGLTAAKCGEQVSFTID
GSQAGTGTPQVQIFSPTSEVDVSIQHLGNNVYRASYTPFTPEPLLMTVSWNGRQLKGCPL
QISVSSAADATRVVCSGQGLKYGVVGQEIRSFIDTRRAGPGELTAHCVGPHKVAYCELYD
HGDATFTLNVKPQEPGRHALTIKYAGEHVTGSPFTLKVSGAPDASKVRVYGPGIEHGVLA
TFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRETQKDRIILCRYDPTEPGDYRVEVR
WAGVLVPGSPFPVKIVDTQDELLMLTQGTDTCTTGHHTITSWRGSQAIL
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atggttggaggttcagcgaggcgtgactcttgggatgcaatagcaaaaacgaagtcgctt
ctttcctccaacagccttgaatctcttgcgaacctggcaaacgattctttgactatcgat
aatacgaagtcgacgaccacgaataatgtcaatgaacagataaccgagaactatactcag
aactcatcttcaaattattcttcgttaaaaaagttttctagttctgaatataattattcg
cccaaagtgaataatgactccttgtctaactcacgagggattttgaaaaataaagttcat
agtacgttaggattggataccactgatacgatgggtaggtctgcagctgcagaatcatcg
gctacgacaacgacgacgtcaacgacgacaacgatgaagacgatacaagaaaaacagcaa
tatcttaatagcgattcttcatttttgcgtaattcattcggccatgataagttggtgtct
ggaagtgcattagaaatgctagcgattcatcgaccaacttccttcatccttgatagtagc
ttggaggcaagcaaaatagctgttatagttactggaccaaatggcagacctgtgcctgtg
caaaagtcgactcttcaaggccaaacttacactgtaacagcagatcaagttggagaacat
actattcaaattctctacaatggaaaacatatcaagggttcaccatttaggtctcaagct
tataattctaaagctattcaagttggaagcattcctaatggcgtagttaacgaacccgtg
gaatttgaaatcgacggctcgagagcaggctccggtaatttggagatactcgtgaatggc
ggacacgtcacaagtttcgtgaggacgctcagcagtcaaagatttttggcatcgttcgtg
cctcacgaggccgtcacacacttggtcgagatgactttcaacggcgagtctgtacccgga
tcaccgtggaaggtcggcataatgccgagccccaagatgtcagtggtcggggactcggtc
aggctcgtcccagctggtagtcccgccgtcttcgagctctcggccctcggtttcagcagc
aacgagatccaagtccaaattctgacgccatcgaagcgacagatcggcgcgcgtatcgac
gaggagcccagtcgtaccggcgagttccgagtgtcgtttacgccgcaggaggtcggcagt
cacttggtcgaggtgagcatagccggacagaagttaccggctgggccactcgtcgccaag
gtctacaacagcagcctcattcaggttaccgaggtgccgagcgccgttgttggccatgcc
tgccaattcagagtggatgcaagcgcggcgggcgagggccagctggagatctcgataaac
gagggcgaggtgccgaaccacgtgcaggtcgtgggcggcggtcgctgcctggtctccttc
acaccggaggcggccaagcctcactacatcgacatcaagttcaacggcgagccagtcccc
ggctgtccattcgtctgccacgtgtcggacacgagtcgcgtcagcctcgaactcgctcat
ctcgagctgctcccggtctcggagcccgcgagcttccacatggccgtcgacggcagcggc
agcgccgagctcgccgtctccgtgcgcggcccctcgagcgagctgcccgtcaaggtcacc
ggcgacatccacacgggcttcacggccgagttcacgccgcgcgaggtcggcgtccacgcg
gtcagcgtcgagtacaacggtcacccggtcaacggcacgcccttcctcgccaaggccttc
gacgcggagcgagtcgtcatcgggcccgtgggccgggccagcgtcggtcaggcccagcac
tttaacgtcgacgcctcccaggccggcgagggcaatctcgagatcacgatatccgcgcgc
ggtcagaacattcctactcaggtgacgccccagggcaacgcgcgcttctccgtgggcttc
gtgccgttcgaagcctgcgagcacatgatcaacatcgcgttcaacaagcgcaccgtgccg
ggctgcccgataatcgcgcgggtagccccggacgctcacgtcacggtcagtggacaagcg
ctcagcagcgcacccctgggcagacagagcgcgctcacactcagcaacgtcgccggtagc
ttggaagacttggaagttaacgttgaaggacccaatggacaggccgtaccggcccaggtc
actgacaacaaagacacgacgtgcacggtggcgttcacgccgaggatcgtcggcgagcac
cggatctcggtcagtcatcgcaatctgccagtcctcggcagtccgttcagctgcaaggtt
tacgacgtgtccgccattaaggtcaaggatgccaagaagggtgtcatcggattgcccgtc
acttttctcgtggaaacaagccaagctggaccaggaaatttggaggtgacggtgaacggc
ggtcgagtgccaacttccgcccaggctcaaggaccacacacgtatgccatctcgttcacg
ccacgcgagcctaccattcacacggtcgacttgcgcttcaacggagaagatgttcccggt
agtccgttcacttgccaggtaactgatactgctaaagtcatcgttaccgaagccttggag
aaggtatccgttaacagagttgctagctttgtcatcgaagccgattcgacgccgacggtt
gatgttctcgctcctacgcgagagagtttacccgtggaaatcgagcaaatcggatctgga
tcttactctgccggctttactcctaaggatgttggtgaccatagcgtacaagtaaaatta
aacggagctcatttgcaaggtagtccctttcttgtcaaagcttataatgcagatcaagtg
aaagtcactgacatcaacagcggagtcgtcggcaagcctgtgttcttcagcatcaacgct
agtcaagctggagcgggaaatttggagatcatcgtcgcagtcaacggcaagaatgtgccc
aacttcgtgcagagtgagggcaacgccaagttccgggtgaatttcaaaccccaggaggct
gcccttcatagcttgagcgtgcgttttaacggagagccagtgccgggatctccgttcacc
tgccaagttctcggtgctggacaggcccttatttcgggtcacaatctaaagatggctgcg
gtcaagcagcccataagctttaccatcgatccgcaagcttcatcgagtaagtgtgacgtt
atcgtcacaccgccttcgaacatcgctctgccgatcaccatagagccacaagatctcaag
tataagatcacattcacgcccactgaagttggacggcacaacgtaagcgtactcgtcgat
ggtgagtcgatcaaaggctcgccattcgcctgcaatgtgtacgacgtcactaagatacat
gtatctggtttgagcgaagccttcttaggtcaagcaacaactttcacagtggatgcagct
caagctggagaaggtacgcttgagctcgttgtgagcaccgaaaacaatactgtcaaagct
gaagtggtagcgtgcgctcgaggcttgtacgacgtgacttttgtgcctcaaacgtcaagc
acgcattacgtgaatatcagtttcaacgacgataatgtaccagggagtcccttcaaatgt
ccagtcattggaagcattttagatggcccttcaatgatcagggtgggaaataccgctttt
atggatttggatatggtcggattaagtggaccaataactgctgaagtaacaggtcccgac
ggaataatcattccttgtaatatgacaaaaattgattctaatttacatcgtgtagaaatt
aaaacgaggaatgtcggaacgtacaatgttgtttttagtcagggttccaaaatcattagt
tcacaatctcttcaagcttttgaccctaccaaggttgtaatacaagaagtgtccgatgca
gtatgtcatcgtccaggaactattttcgttgttgcaccgaaggaagctggtcccggaaag
ctcacagttagcgttcgttccggaggtgctgaagtcgacagcctagttcgagaaaaagac
aatggaatctatgaaatcattttccatccaaccaggacggcgcctcatcgagttcatata
aaatacaacgatgtatatatacaaggaagccctcttgaagtagcagtgcgaggcccgaca
ggaggacgagaagtcactgccactggattgggtctgtatcaatcctgtattggcaaggtc
acgtcattttctattgaaacactcggacgtccaggaaaggaatttgacgttgttataagt
agtccacaaggtaatgcagtaccagttcgctgttatcagcatcgtgacggaaacttatta
gccgagtttacaacgaattctgttggaacatataaaattgatgttctgcacggagctaag
cctgtattaggttcgccatttttctgccaagcatttgatgcaagtaaaattaagcttcaa
gaactgggacctacaactgtatctgttcatgatcattttgccctaaaaattatcaaagca
gaagcgggagtagcagagctggacgtagcagcgactagtccgttgggtcaagagctggcc
atgcaagtaagaccgctcaacgatggagcagaaatgattgagttctcacccagcgtcgct
ggatcatatgtcatcaacgtcagctacgggggctgtacggtacctggcagtcccgttgta
gttgtagctgaggccgctggtcaggcgcgtgccaagggccagggtttaattcagggtcat
gttggtaaaccagcccattttctcgttacgggcagcagaagtccacccgctgtgcaagtc
gacggccctgatagcgttgccaagcctactgtggaagctgggcctaatcctggaacctgg
aacgtttcatacgtgcctactgaacctggactctttgatgttagagtcgtttgcgcaggg
caacagcttcccggttcaccttggcatccgagaattattgacactcgcaatcttcgcgtt
attggtggatggagtgcactttgtgatgagcttggacgtttaaagattgcgcctggtaac
aaaattagttttgatacctccgaagctggacctggagagttaagtggacgaattgacgat
caaccactgaaatttgagatgacaacgaataacagactgaaattaattatacctcagtta
gctgctggagaacatggaatggaaattctatttaatgctgttcccttccctggcgcacca
aaactagccatcgccccagaactagaatcttccatgtcacaggatacaagtagggtaatg
ttaagaggcagaggcttgacagcagctaagtgcggagaacaagtcagctttaccattgac
ggttcgcaagctggtacaggaacgccacaagttcaaatattctcacctacaagtgaagta
gacgtatccatacaacatttaggaaacaatgtttatcgagctagttacacaccatttacg
ccggaacctttgctaatgacagtttcatggaatggtcggcaactaaaaggatgcccgtta
caaataagcgtatctagtgcagctgatgctactcgcgtagtctgttccggtcaagggtta
aaatatggcgttgttggacaggaaataagaagttttatagacacaagacgagcagggcca
ggcgaattgacagctcactgtgtcgggccgcataaggtggcctactgtgaattatacgat
catggtgatgcgactttcacacttaacgtcaaaccgcaagaaccaggaaggcatgcttta
actatcaaatatgctggagaacatgtaacagggtcaccatttacgttaaaggtttccggt
gcgcctgatgcatctaaggtaagagtttacggccctggaatagagcatggcgtattggcg
actttccagtcgcgatttatctgtgacacaaggggggctggagctggtcaattaacagtg
agagtacgaggtccaaagggtgcattccgagttgagatgcagcgagaaactcaaaaagac
agaataattttatgtcgctacgatccgactgaaccaggagattatcgcgttgaagtccgg
tgggcaggagtgcttgttccaggttcaccttttcccgttaaaatagtcgatacccaagat
gaattattaatgttaacacaaggcactgacacttgtacaacaggccatcacactatcacg
tcatggcgaggatcccaagcgatcttataa

DBGET integrated database retrieval system