KEGG   Nasonia vitripennis (jewel wasp): 100113977Help
Entry
100113977         CDS       T01081                                 

Definition
filamin-A
Orthology
K04437  
filamin
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100113977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 2874 aa AA seqDB search
MQEKGQSDRLEPAELVGLVARSAEGTAAKGMPIKGHEDLWVDIQANTFRNWVNEHLKQSD
RGRECGPVLDLADDFRDGTRLCALVEILTCKRLAKWNPNPVNQHHYLENVSTALKAVEAD
GVKLVNIGNVDIVNGNLKLILGLIWSLIVRYQIGKSKFPPRKLMLSWLKAVLPECRVNNF
TTDWNSGVYLSALLNYCKPGLFPHWRQLDPNDSVYNCRKAMEISKREFDIPMVLQPEYLA
SPYLDELSGMTYLSYFMKEGSPGFHSTLRWVNSQLPHSPVRNFTTDWNDGRALCSIVRNL
GGPAPAYDKIDTSPLSWEHNLQMGIDGGKKLGVEPLLKAKDMADQNVEHLGVMAYAAYFQ
WVKPRPQVSEQVAVHIDSTSARVHQPAYFKLELLSKEVNTRDVRGEVIGPSGCMECRLSW
NGAHGKGTFVPTEVGMHKLMVYNDGELLNGCPYYFRVHPPLTKIKSPGMDPCAIGSIVEV
LVNSYGTSQEGINVTAWSPAGRALSCPVRENDGVHVATFQPDETGEWSIAITHKGAHIQG
GPFTCFVFDPNGVQLHDLDGAIPGQSFAFTVDATSTGGLGDIVIDIVHDKQSVPHFIQEL
SHMNYRVSFVPRDLGKYRVYVYFNGSDVRGSPFSLRVGTSRGSRRSRESSHAGSLERSNI
ASLERKRNGHHTPDNGSTPTALRSPVYKSPSPSSYTSTYNKTFDRVNNHHSSTKNSHSPP
LINERKDTYATNMYNQLHNKSPTWSSPNFYDRSKSPSMSPKPGDQDHHKFHSNRRGSTEN
GIMSSMVGGSARRDSWDAIAKTKSLLSSNSLESLANLANDSLTIDNTKSTTTNNVNEQIT
ENYTQNSSSNYSSLKKFSSSEYNYSPKVNNDSLSNSRGILKNKVHSTLGLDTTDTMGRSA
AAESSATTTTTSTTTTMKTIQEKQQYLNSDSSFLRNSFGHDKLVSGSALEMLAIHRPTSF
ILDSSLEASKIAVIVTGPNGRPVPVQKSTLQGQTYTVTADQVGEHTIQILYNGKHIKGSP
FRSQAYNSKAIQVGSIPNGVVNEPVEFEIDGSRAGSGNLEILVNGGHVTSFVRTLSSQRF
LASFVPHEAVTHLVEMTFNGESVPGSPWKVGIMPSPKMSVVGDSVRLVPAGSPAVFELSA
LGFSSNEIQVQILTPSKRQIGARIDEEPSRTGEFRVSFTPQEVGSHLVEVSIAGQKLPAG
PLVAKVYNSSLIQVTEVPSAVVGHACQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGR
CLVSFTPEAAKPHYIDIKFNGEPVPGCPFVCHVSDTSRVSLELAHLELLPVSEPASFHMA
VDGSGSAELAVSVRGPSSELPVKVTGDIHTGFTAEFTPREVGVHAVSVEYNGHPVNGTPF
LAKAFDAERVVIGPVGRASVGQAQHFNVDASQAGEGNLEITISARGQNIPTQVTPQGNAR
FSVGFVPFEACEHMINIAFNKRTVPGCPIIARVAPDAHVTVSGQALSSAPLGRQSALTLS
NVAGSLEDLEVNVEGPNGQAVPAQVTDNKDTTCTVAFTPRIVGEHRISVSHRNLPVLGSP
FSCKVYDVSAIKVKDAKKGVIGLPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGPHTY
AISFTPREPTIHTVDLRFNGEDVPGSPFTCQVTDTAKVIVTEALEKVSVNRVASFVIEAD
STPTVDVLAPTRESLPVEIEQIGSGSYSAGFTPKDVGDHSVQVKLNGAHLQGSPFLVKAY
NADQVKVTDINSGVVGKPVFFSINASQAGAGNLEIIVAVNGKNVPNFVQSEGNAKFRVNF
KPQEAALHSLSVRFNGEPVPGSPFTCQVLGAGQALISGHNLKMAAVKQPISFTIDPQASS
SKCDVIVTPPSNIALPITIEPQDLKYKITFTPTEVGRHNVSVLVDGESIKGSPFACNVYD
VTKIHVSGLSEAFLGQATTFTVDAAQAGEGTLELVVSTENNTVKAEVVACARGLYDVTFV
PQTSSTHYVNISFNDDNVPGSPFKCPVIGSILDGPSMIRVGNTAFMDLDMVGLSGPITAE
VTGPDGIIIPCNMTKIDSNLHRVEIKTRNVGTYNVVFSQGSKIISSQSLQAFDPTKVVIQ
EVSDAVCHRPGTIFVVAPKEAGPGKLTVSVRSGGAEVDSLVREKDNGIYEIIFHPTRTAP
HRVHIKYNDVYIQGSPLEVAVRGPTGGREVTATGLGLYQSCIGKVTSFSIETLGRPGKEF
DVVISSPQGNAVPVRCYQHRDGNLLAEFTTNSVGTYKIDVLHGAKPVLGSPFFCQAFDAS
KIKLQELGPTTVSVHDHFALKIIKAEAGVAELDVAATSPLGQELAMQVRPLNDGAEMIEF
SPSVAGSYVINVSYGGCTVPGSPVVVVAEAAGQARAKGQGLIQGHVGKPAHFLVTGSRSP
PAVQVDGPDSVAKPTVEAGPNPGTWNVSYVPTEPGLFDVRVVCAGQQLPGSPWHPRIIDT
RNLRVIGGWSALCDELGRLKIAPGNKISFDTSEAGPGELSGRIDDQPLKFEMTTNNRLKL
IIPQLAAGEHGMEILFNAVPFPGAPKLAIAPELESSMSQDTSRVMLRGRGLTAAKCGEQV
SFTIDGSQAGTGTPQVQIFSPTSEVDVSIQHLGNNVYRASYTPFTPEPLLMTVSWNGRQL
KGCPLQISVSSAADATRVVCSGQGLKYGVVGQEIRSFIDTRRAGPGELTAHCVGPHKVAY
CELYDHGDATFTLNVKPQEPGRHALTIKYAGEHVTGSPFTLKVSGAPDASKVRVYGPGIE
HGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRETQKDRIILCRYDPTEPGDY
RVEVRWAGVLVPGSPFPVKIVDTQDELLMLTQGTDTCTTGHHTITSWRGSQAIL
NT seq 8625 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaagggacagagcgacaggctcgagccggcggaactggtgggcttggtggcg
cgttcggccgagggaaccgccgccaagggcatgccgatcaagggccacgaggatctctgg
gtcgacatccaggcgaacaccttcaggaactgggtgaacgagcatctcaagcagtcggac
agaggacgggagtgcggaccggtgctcgacttggccgacgactttagggacggcacgagg
ctctgcgcgctcgtcgagatactcacctgcaagcggctggctaagtggaatcccaacccg
gtcaaccagcatcactacctcgagaacgtatccactgcgctcaaggccgtcgaggccgac
ggggtcaagctcgttaatatcggcaatgtggacatcgtcaacggtaacctcaagctgatt
ctcggtttaatatggtcactcattgtcagataccaaataggcaagtccaaattcccaccg
aggaaactcatgctctcgtggctcaaggcggttctaccagaatgcagagtgaacaatttc
acgacggactggaattccggtgtttatctgagcgcactgctaaattactgcaaacctgga
ctcttcccgcactggcgtcaacttgatcccaatgacagcgtctacaattgtcggaaagct
atggagatatcaaaacgagaattcgacattcccatggttctgcagcccgagtatctcgct
tccccgtatttggatgagttgtccggtatgacttacttgtcgtattttatgaaggaaggc
tcgccgggttttcactctacacttcgatgggttaattctcaacttccacacagtccagtc
agaaattttacaacagactggaacgacggcagagcgctctgcagcatcgttagaaatttg
ggaggacctgctccagcctacgataaaattgacacgagcccgttatcatgggaacataat
ttacaaatgggtattgacggaggaaaaaaattgggtgtagaaccattgttgaaagcaaag
gacatggcagatcaaaacgtcgaacatcttggtgtcatggcctatgcagcttattttcag
tgggtcaaacctcggccgcaagtgagtgaacaagttgccgtacatatcgacagcacgtca
gcaagagttcaccaaccagcctactttaaactggaattattatccaaagaggttaatacg
agagacgttcgtggtgaggtaatcggccccagcggttgcatggaatgcagactgtcgtgg
aatggagctcatgggaaaggaactttcgttccaactgaagtcggaatgcataaattgatg
gtgtacaatgatggcgaactgttgaatggatgtccttattatttccgagttcatcctccg
cttaccaaaatcaaatcaccaggcatggacccctgcgcaataggatccattgtcgaagtt
ctagtcaatagctatggaactagtcaagagggcatcaatgtcacggcatggtcgccagca
ggtcgtgccttgagttgtccagtgagggaaaatgacggagtgcacgtagctacattccaa
ccggacgaaaccggcgagtggagtatagccatcacacataagggcgcgcacatacagggt
ggcccgtttacctgttttgtcttcgaccctaatggagttcaactgcacgacttggacggc
gcgataccaggccagtcgtttgccttcaccgtcgatgccaccagcacaggtggcctcggt
gacattgtcattgacatcgtccatgataaacagtccgttcctcacttcattcaagagttg
tcacacatgaactaccgtgtctcattcgtgccacgcgatctcggaaagtatcgagtctac
gtatactttaatggttcagatgttcgaggttcgcctttttcacttcgagtcggaacttcg
cgaggctctcggcgctccagggagtcatcccatgcaggtagtttggaaagatctaacatc
gcatctttggagcgaaagagaaatggacatcatactccggataatggttctactcccact
gccctgagatctccggtgtacaaaagtccctcgccatcttcttacacaagtacctataac
aaaactttcgacagagtgaataatcatcattcatcgacaaaaaattcgcacagtccgcca
ttgatcaacgagaggaaggatacatatgctaccaatatgtataatcaactccacaataaa
tcacctacttggtctagtccgaacttttatgatcgatctaaatcacccagtatgagtcct
aaacccggagatcaagatcaccacaaattccatagcaataggcggggatcgaccgagaat
ggcattatgtcatcgatggttggaggttcagcgaggcgtgactcttgggatgcaatagca
aaaacgaagtcgcttctttcctccaacagccttgaatctcttgcgaacctggcaaacgat
tctttgactatcgataatacgaagtcgacgaccacgaataatgtcaatgaacagataacc
gagaactatactcagaactcatcttcaaattattcttcgttaaaaaagttttctagttct
gaatataattattcgcccaaagtgaataatgactccttgtctaactcacgagggattttg
aaaaataaagttcatagtacgttaggattggataccactgatacgatgggtaggtctgca
gctgcagaatcatcggctacgacaacgacgacgtcaacgacgacaacgatgaagacgata
caagaaaaacagcaatatcttaatagcgattcttcatttttgcgtaattcattcggccat
gataagttggtgtctggaagtgcattagaaatgctagcgattcatcgaccaacttccttc
atccttgatagtagcttggaggcaagcaaaatagctgttatagttactggaccaaatggc
agacctgtgcctgtgcaaaagtcgactcttcaaggccaaacttacactgtaacagcagat
caagttggagaacatactattcaaattctctacaatggaaaacatatcaagggttcacca
tttaggtctcaagcttataattctaaagctattcaagttggaagcattcctaatggcgta
gttaacgaacccgtggaatttgaaatcgacggctcgagagcaggctccggtaatttggag
atactcgtgaatggcggacacgtcacaagtttcgtgaggacgctcagcagtcaaagattt
ttggcatcgttcgtgcctcacgaggccgtcacacacttggtcgagatgactttcaacggc
gagtctgtacccggatcaccgtggaaggtcggcataatgccgagccccaagatgtcagtg
gtcggggactcggtcaggctcgtcccagctggtagtcccgccgtcttcgagctctcggcc
ctcggtttcagcagcaacgagatccaagtccaaattctgacgccatcgaagcgacagatc
ggcgcgcgtatcgacgaggagcccagtcgtaccggcgagttccgagtgtcgtttacgccg
caggaggtcggcagtcacttggtcgaggtgagcatagccggacagaagttaccggctggg
ccactcgtcgccaaggtctacaacagcagcctcattcaggttaccgaggtgccgagcgcc
gttgttggccatgcctgccaattcagagtggatgcaagcgcggcgggcgagggccagctg
gagatctcgataaacgagggcgaggtgccgaaccacgtgcaggtcgtgggcggcggtcgc
tgcctggtctccttcacaccggaggcggccaagcctcactacatcgacatcaagttcaac
ggcgagccagtccccggctgtccattcgtctgccacgtgtcggacacgagtcgcgtcagc
ctcgaactcgctcatctcgagctgctcccggtctcggagcccgcgagcttccacatggcc
gtcgacggcagcggcagcgccgagctcgccgtctccgtgcgcggcccctcgagcgagctg
cccgtcaaggtcaccggcgacatccacacgggcttcacggccgagttcacgccgcgcgag
gtcggcgtccacgcggtcagcgtcgagtacaacggtcacccggtcaacggcacgcccttc
ctcgccaaggccttcgacgcggagcgagtcgtcatcgggcccgtgggccgggccagcgtc
ggtcaggcccagcactttaacgtcgacgcctcccaggccggcgagggcaatctcgagatc
acgatatccgcgcgcggtcagaacattcctactcaggtgacgccccagggcaacgcgcgc
ttctccgtgggcttcgtgccgttcgaagcctgcgagcacatgatcaacatcgcgttcaac
aagcgcaccgtgccgggctgcccgataatcgcgcgggtagccccggacgctcacgtcacg
gtcagtggacaagcgctcagcagcgcacccctgggcagacagagcgcgctcacactcagc
aacgtcgccggtagcttggaagacttggaagttaacgttgaaggacccaatggacaggcc
gtaccggcccaggtcactgacaacaaagacacgacgtgcacggtggcgttcacgccgagg
atcgtcggcgagcaccggatctcggtcagtcatcgcaatctgccagtcctcggcagtccg
ttcagctgcaaggtttacgacgtgtccgccattaaggtcaaggatgccaagaagggtgtc
atcggattgcccgtcacttttctcgtggaaacaagccaagctggaccaggaaatttggag
gtgacggtgaacggcggtcgagtgccaacttccgcccaggctcaaggaccacacacgtat
gccatctcgttcacgccacgcgagcctaccattcacacggtcgacttgcgcttcaacgga
gaagatgttcccggtagtccgttcacttgccaggtaactgatactgctaaagtcatcgtt
accgaagccttggagaaggtatccgttaacagagttgctagctttgtcatcgaagccgat
tcgacgccgacggttgatgttctcgctcctacgcgagagagtttacccgtggaaatcgag
caaatcggatctggatcttactctgccggctttactcctaaggatgttggtgaccatagc
gtacaagtaaaattaaacggagctcatttgcaaggtagtccctttcttgtcaaagcttat
aatgcagatcaagtgaaagtcactgacatcaacagcggagtcgtcggcaagcctgtgttc
ttcagcatcaacgctagtcaagctggagcgggaaatttggagatcatcgtcgcagtcaac
ggcaagaatgtgcccaacttcgtgcagagtgagggcaacgccaagttccgggtgaatttc
aaaccccaggaggctgcccttcatagcttgagcgtgcgttttaacggagagccagtgccg
ggatctccgttcacctgccaagttctcggtgctggacaggcccttatttcgggtcacaat
ctaaagatggctgcggtcaagcagcccataagctttaccatcgatccgcaagcttcatcg
agtaagtgtgacgttatcgtcacaccgccttcgaacatcgctctgccgatcaccatagag
ccacaagatctcaagtataagatcacattcacgcccactgaagttggacggcacaacgta
agcgtactcgtcgatggtgagtcgatcaaaggctcgccattcgcctgcaatgtgtacgac
gtcactaagatacatgtatctggtttgagcgaagccttcttaggtcaagcaacaactttc
acagtggatgcagctcaagctggagaaggtacgcttgagctcgttgtgagcaccgaaaac
aatactgtcaaagctgaagtggtagcgtgcgctcgaggcttgtacgacgtgacttttgtg
cctcaaacgtcaagcacgcattacgtgaatatcagtttcaacgacgataatgtaccaggg
agtcccttcaaatgtccagtcattggaagcattttagatggcccttcaatgatcagggtg
ggaaataccgcttttatggatttggatatggtcggattaagtggaccaataactgctgaa
gtaacaggtcccgacggaataatcattccttgtaatatgacaaaaattgattctaattta
catcgtgtagaaattaaaacgaggaatgtcggaacgtacaatgttgtttttagtcagggt
tccaaaatcattagttcacaatctcttcaagcttttgaccctaccaaggttgtaatacaa
gaagtgtccgatgcagtatgtcatcgtccaggaactattttcgttgttgcaccgaaggaa
gctggtcccggaaagctcacagttagcgttcgttccggaggtgctgaagtcgacagccta
gttcgagaaaaagacaatggaatctatgaaatcattttccatccaaccaggacggcgcct
catcgagttcatataaaatacaacgatgtatatatacaaggaagccctcttgaagtagca
gtgcgaggcccgacaggaggacgagaagtcactgccactggattgggtctgtatcaatcc
tgtattggcaaggtcacgtcattttctattgaaacactcggacgtccaggaaaggaattt
gacgttgttataagtagtccacaaggtaatgcagtaccagttcgctgttatcagcatcgt
gacggaaacttattagccgagtttacaacgaattctgttggaacatataaaattgatgtt
ctgcacggagctaagcctgtattaggttcgccatttttctgccaagcatttgatgcaagt
aaaattaagcttcaagaactgggacctacaactgtatctgttcatgatcattttgcccta
aaaattatcaaagcagaagcgggagtagcagagctggacgtagcagcgactagtccgttg
ggtcaagagctggccatgcaagtaagaccgctcaacgatggagcagaaatgattgagttc
tcacccagcgtcgctggatcatatgtcatcaacgtcagctacgggggctgtacggtacct
ggcagtcccgttgtagttgtagctgaggccgctggtcaggcgcgtgccaagggccagggt
ttaattcagggtcatgttggtaaaccagcccattttctcgttacgggcagcagaagtcca
cccgctgtgcaagtcgacggccctgatagcgttgccaagcctactgtggaagctgggcct
aatcctggaacctggaacgtttcatacgtgcctactgaacctggactctttgatgttaga
gtcgtttgcgcagggcaacagcttcccggttcaccttggcatccgagaattattgacact
cgcaatcttcgcgttattggtggatggagtgcactttgtgatgagcttggacgtttaaag
attgcgcctggtaacaaaattagttttgatacctccgaagctggacctggagagttaagt
ggacgaattgacgatcaaccactgaaatttgagatgacaacgaataacagactgaaatta
attatacctcagttagctgctggagaacatggaatggaaattctatttaatgctgttccc
ttccctggcgcaccaaaactagccatcgccccagaactagaatcttccatgtcacaggat
acaagtagggtaatgttaagaggcagaggcttgacagcagctaagtgcggagaacaagtc
agctttaccattgacggttcgcaagctggtacaggaacgccacaagttcaaatattctca
cctacaagtgaagtagacgtatccatacaacatttaggaaacaatgtttatcgagctagt
tacacaccatttacgccggaacctttgctaatgacagtttcatggaatggtcggcaacta
aaaggatgcccgttacaaataagcgtatctagtgcagctgatgctactcgcgtagtctgt
tccggtcaagggttaaaatatggcgttgttggacaggaaataagaagttttatagacaca
agacgagcagggccaggcgaattgacagctcactgtgtcgggccgcataaggtggcctac
tgtgaattatacgatcatggtgatgcgactttcacacttaacgtcaaaccgcaagaacca
ggaaggcatgctttaactatcaaatatgctggagaacatgtaacagggtcaccatttacg
ttaaaggtttccggtgcgcctgatgcatctaaggtaagagtttacggccctggaatagag
catggcgtattggcgactttccagtcgcgatttatctgtgacacaaggggggctggagct
ggtcaattaacagtgagagtacgaggtccaaagggtgcattccgagttgagatgcagcga
gaaactcaaaaagacagaataattttatgtcgctacgatccgactgaaccaggagattat
cgcgttgaagtccggtgggcaggagtgcttgttccaggttcaccttttcccgttaaaata
gtcgatacccaagatgaattattaatgttaacacaaggcactgacacttgtacaacaggc
catcacactatcacgtcatggcgaggatcccaagcgatcttataa

DBGET integrated database retrieval system