KEGG   Nasonia vitripennis (jewel wasp): 100114103Help
Entry
100114103         CDS       T01081                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    100114103
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100114103
Transcription factors [BR:nvi03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100114103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
Un
AA seq 728 aa AA seqDB search
MASCIRNRNSTRHCDEAIDDDNDEKDDTKRKSRNLSEKKRRDQFNMLVNELGSMVNTNTR
KMDKSSVLKSTILFLKNHNELAVRSRTHEIQEDWKPSFLSNEEFTHLTLEALDGFIMLFS
LSGRIFYVSESITSLLGYLPSELTNTTIYEIALQEDQSHLYNTLANASNTRDQNSIKTEH
QVSFTCHIKRGGLDFREEPIYELVQFIGYFRTGNDADVDNMIPNNRFGSCATGETKTVFV
CTGRLQVPQLIREMSVVDNTKTEFTSKHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDY
YHIDDLDKVVTCHESLMKKGEGTSCYYRFLTKGQQWIWLQTRFYITYNQWHSNPEFIVCT
HHVVSYTDVVKHLRIQEDEMSSTKRPSNISSHIRISSWSAKSSKTSRPAAVRSLLRHQSD
ESDSTAATVCSKSSQSFQSMPQSVPKTKIAPTNSLTSYKPIMPSNDNTSTDTQPQQQTHP
AYQQSQPQQPQQPQEQQQQDQQAAQKMKVEQQHCSDFVEPTQFSAEPMETVVGGSYSGTT
DPSLITLLQTTEMRHQPGLVITPVQNQIQDELQRKHEELQQLIVHQQEELRRVSEQLLIA
RYGMFSPLLNMGVPYNANLCQQPTHCSSTPNHSVPGVTALAVPIALPLNIVPPELFPHSP
SVNTVLNTSISDHSNVIQMMTPQQQQQQQQQRQQLQIRPHQQLTQQHQPKEQTTDIIAFQ
MCQQNDLL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgtattagaaacagaaactccactcgacattgcgacgaagccatcgacgat
gataacgatgaaaaggacgacacaaaaaggaaatcccgaaatctaagtgagaagaaacgg
cgagaccagttcaacatgctagttaatgaactaggtagtatggttaacactaacacaagg
aaaatggataaatcgtcggtccttaagtcaacaatacttttcttaaaaaatcacaatgaa
cttgcagtaagatcaagaactcacgaaatacaagaagactggaagccttcctttctatca
aacgaagaatttacacatttgacgttagaggctctcgatggttttattatgttgttctct
ttatccggccgaatattttacgtttctgaaagtataacttcccttttgggttaccttcca
agtgaattaacgaatacaactatctatgaaattgctttgcaagaggatcagtctcatcta
tacaacacattagctaatgccagcaatacgagggatcaaaatagtattaaaacagagcat
caagtatcatttacatgccacattaagagaggaggtttggacttcagagaagagccaatt
tatgaacttgtgcaatttataggatattttcgtacaggcaacgacgctgatgttgataat
atgataccaaataatagatttggtagttgtgccactggagaaacaaaaactgtttttgta
tgcactggacgacttcaagtaccacaattaatacgtgaaatgtctgttgtggataatacc
aaaaccgaatttacctctaaacatagcttagaatggaaatttctttttctggatcatcgg
gcaccgccaattattggatatttgccgtttgaagttctcggaacatctggttacgactac
taccatatagacgaccttgacaaagttgtcacgtgtcatgaatctttgatgaaaaagggc
gaaggtacgtcgtgttactatagattccttacaaaaggccagcaatggatttggctgcaa
accaggttctacataacgtataatcagtggcactccaaccctgaattcatcgtatgcacg
caccacgttgtcagctatacagacgtggtcaaacatttgaggatacaggaagacgaaatg
tcatcaacaaaacgacccagtaatatttcaagtcatatacgcatatcatcttggtcggcg
aaatcttcgaaaacttcgcgaccagcagcggtgcgttcactactacggcatcaaagtgat
gaatccgattcaacagcagcaacagtatgttccaagagctctcagtcttttcaatcaatg
ccgcagtcagtcccaaagacaaagatagctccaaccaatagcttgacaagttataagccc
atcatgccaagcaatgataatacgtcaacggacactcaaccccagcagcaaacacatcct
gcttatcaacaatcgcagccacaacagccgcaacagccacaagagcagcaacagcaggat
cagcaagcggcacaaaaaatgaaagtagagcaacagcattgttctgattttgtggaacct
acacaattttcagccgaaccaatggaaacggttgtcggtggttcttactcaggaacgacg
gatccgtcattgatcacactgctacaaacgaccgagatgcgtcatcagccaggcttagtg
ataacaccagtgcaaaatcaaattcaggatgaactgcagcgaaagcatgaggaactccag
cagttaattgttcaccaacaggaagagttaagaagagtatcagagcaattattgatagct
agatatggaatgttttcaccgttacttaatatgggagtaccgtacaatgcaaatctatgc
caacaacctactcattgttcaagtactccaaatcatagtgtgccaggtgtaactgcatta
gcggtgccaatcgcacttccactaaatattgtacctccagaactgtttcctcattcccca
tcagtaaatacagtcttgaacacgtccatatcagaccacagtaatgtcatccagatgatg
actccacaacaacaacaacaacagcagcaacaacgacaacagctacagatacgacctcat
caacagttaacccaacagcatcaaccaaaggagcagacaacggatatcattgccttccaa
atgtgccaacagaacgacctactttaa

DBGET integrated database retrieval system