KEGG   Nasonia vitripennis (jewel wasp): 100114163Help
Entry
100114163         CDS       T01081                                 

Definition
profilin-like
Orthology
K05759  
profilin
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100114163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 126 aa AA seqDB search
MSWQDYVDKQLLASRCVSKAAIAGHDGNVWAKSEGFEVSKEELAKLAQGFDEQELLTSSG
VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTSQAVVVSLYEDPIQPQQAASVVEKLGDY
LLSCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgtcgacaagcagctgctcgcctcgagatgtgtgtccaaagcg
gcgatcgccggacacgacggcaacgtctgggcaaagtccgagggcttcgaagttagcaaa
gaggaactggcaaagctggcccaaggcttcgatgagcaggaactgctgacgtcgtcgggg
gtgacccttgccggcaataggtatatctatctgtcgggcacagaccgtgtgataagggca
aagctgggcaaagtcggcgtacactgcatgaagacgtcgcaggcggtcgtcgtatccctc
tacgaggacccgatacagccacagcaggccgcctccgttgtcgaaaagttgggcgactac
ctcctgtcctgcggctattag

DBGET integrated database retrieval system