KEGG   Nasonia vitripennis (jewel wasp): 100114163Help
Entry
100114163         CDS       T01081                                 

Definition
(RefSeq) profilin
  KO
K05759  
profilin
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100114163
Cytoskeleton proteins [BR:nvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100114163
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100114163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 126 aa AA seqDB search
MSWQDYVDKQLLASRCVSKAAIAGHDGNVWAKSEGFEVSKEELAKLAQGFDEQELLTSSG
VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTSQAVVVSLYEDPIQPQQAASVVEKLGDY
LLSCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgtcgacaagcagctgctcgcctcgagatgtgtgtccaaagcg
gcgatcgccggacacgacggcaacgtctgggcaaagtccgagggcttcgaagttagcaaa
gaggaactggcaaagctggcccaaggcttcgatgagcaggaactgctgacgtcgtcgggg
gtgacccttgccggcaataggtatatctatctgtcgggcacagaccgtgtgataagggca
aagctgggcaaagtcggcgtacactgcatgaagacgtcgcaggcggtcgtcgtatccctc
tacgaggacccgatacagccacagcaggccgcctccgttgtcgaaaagttgggcgactac
ctcctgtcctgcggctattag

DBGET integrated database retrieval system