KEGG   Nasonia vitripennis (jewel wasp): 100114234Help
Entry
100114234         CDS       T01081                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100114234
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100114234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 696 aa AA seqDB search
MFTCISKLNIFGHKRSVNIEKKTNDQNNSHLHGLYASKLSKEYATAGDFDDVHNLLVVNS
KDLSDSSVSSCSYEKSNHRGGIIGKTPSLQSEPIPIYHKDERSQQQIKKAIIENEFLGNL
EESQINTIVSAMYPKLIKPNTLVIQEGDIGSHLYVSAVGEFDIYRGTNFQRSFGPGVAFG
ELALLYNTKRLRSISVSKPFTVRREGKVWILDRSIFSTIMMRSVQNKLEDNLRFLKRVSV
LQKLPEPKEHVLSKISDLIKIEFYPAGAQIVRQGEKGNKFYIISGGTVRVTKDTDFGEEE
LVVLCKGQYFGEKALYDDSGENRRHANVIALDPVECLTLDRTSFLNYLGSLEEIRNKDWL
SELNKQKRTLTPKRWKTEYEKLTLSDFQIRGTLGVGGFGRVDLVTLHSDAKKSFALKKLK
KKVMVDLQQQEHVLNEKRIMQACESPFICKLYKTYKDNKFVYFLMEVCLGGDVWTTLQRR
RRFDDETSQFMIACVVEALDHLHSMNIIYRDLKPENLMLDNRGYVKLIDFGFSKRIGPSK
TWTFAGTPEYVAPEIILNKGHDRAVDYWALGILTHELLIGRPPFRGPDHMTTYNKILKGI
EVAGIPNNVNKSANFFIKKLLRSSPLERLGYQRNGIQDIRDHKWFFNFNWTALQRLTLPA
PIVPTIRSSTDTRNFERYPPDKELPPDENSNWDIEF
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtttacctgtatttctaaattaaacatttttggtcataaaagaagtgttaatatagaa
aaaaaaactaatgatcaaaacaattctcacttacatggactatatgcgagcaaactgtcg
aaggagtatgcaacagcaggtgatttcgatgatgtgcacaatttacttgtagttaattct
aaagatttatcagactcatcagtctcatcatgttcttatgagaaaagcaaccataggggc
ggaataattggtaaaacaccatcgctacaatcagaacctataccaatctatcataaggat
gagagatcacagcaacaaattaaaaaagcaataattgaaaacgaatttttgggaaattta
gaggagtcacaaataaatactattgtatcagccatgtatccgaaattaatcaaaccaaat
acacttgtgattcaagaaggtgatataggatctcatttatatgtatccgctgtgggtgaa
ttcgacatttacagaggaacaaattttcaacgtagttttgggcctggagtagcttttggt
gaattagctcttctgtataataccaaaagacttcgttctattagtgtttctaaaccattc
acagttagaagagaaggaaaggtttggattcttgatagatcaatattttcaactattatg
atgaggagtgttcaaaataaattagaagataatttacgttttttgaaaagagtttctgtg
ttgcaaaaattaccagaaccaaaggaacatgtactatcgaaaatatcagatttaataaaa
atagaattttatccagctggtgcgcaaattgtacggcaaggtgaaaaagggaataaattt
tacatcattagcggaggaaccgttagagttacaaaggatactgattttggcgaagaagaa
ttagttgttctttgcaaaggccaatactttggcgaaaaagcactttatgatgatagtggt
gaaaaccgaagacatgctaatgtgattgctttagatccagttgaatgtctaactttagac
agaacatcttttctgaactatttaggaagtttggaggaaattcgtaataaagattggtta
tcagagctaaataaacaaaaacgcactcttactccgaaaagatggaaaactgaatatgaa
aaactaacgttgtctgactttcaaataagaggtaccttaggggttggtggatttggacgt
gttgatttagttacattacactcagatgctaaaaaaagttttgctttaaaaaaactaaaa
aagaaagttatggttgatttacagcaacaagagcatgttcttaacgagaagcgcataatg
caggcttgcgaatccccattcatttgcaagctttataaaacatataaagacaacaaattt
gtctactttttaatggaagtatgtcttggaggtgacgtttggactaccttacaaaggcgg
cgtcgttttgatgacgaaacatctcagtttatgatagcttgtgtagttgaagcattagat
caccttcattctatgaacataatttatagagatttaaaacctgaaaatttaatgttagat
aatcgaggatatgtaaaactcattgattttggatttagtaaaagaataggtccatcaaaa
acatggacttttgctggcactccagaatatgtagctcctgaaattatacttaataaggga
cacgacagagctgttgattattgggcccttggaatactaacgcacgaattattaattggc
agaccaccttttagaggacccgatcatatgactacttataataaaatcctaaaaggaata
gaagtagctggaatacctaataatgttaataagagcgctaatttttttattaaaaaattg
cttcggtcaagtcctttagagcgattaggataccaacgtaacggtattcaagacatacga
gaccacaagtggttttttaattttaactggacagcattacagagattaacattacctgct
ccgatagtacctacaatacgtagctcaactgacactcgaaattttgaaagatatccacct
gataaagaattacctccagatgaaaattccaattgggatattgaattttaa

DBGET integrated database retrieval system