KEGG   Nasonia vitripennis (jewel wasp): 100114328Help
Entry
100114328         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 47-like
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 1277 aa AA seqDB search
MVEVKYVYFTSQSNHSGILERTAPAKYVKTAKVLSDVIIQRIENTGCKYKDICILKLKLP
NDKEQDITASMFSPANLENVLEEVIRTLPPEDETPSLQLSMEWYKEHRGVRVPKNVSRPV
KPATKYKSCTESYDNSSKILCNDTETLKPNYVGLVNQAMTCYLNSLLQALYMTPEFRNAL
YNWEYKSSEKNTTNSSTTSNSIPYQLQKLFLNLQTSQKTAVETTSLTKSFGWNSNDAWHQ
HDIQELCRVMFDALELTFTNTAQADLINRLYEGKINDYVKCLTCNTEKFREDTFLDIPLP
VRPFDTNVAYGSVEEALEAFVKYETLEGNNQYFCEKCDKKSNAHKGLKFTKFPYILTLQL
KRFDFDQNTYHRIKLNDKVTFPDVLNLNTFIESSSNKESPLNEEDAGMSVKCDDSITTDS
STMDETEYASSDIILSNSNHLSNPDQDDDEGIDVSNGMSSSSSSMHNNNAEKIREDYAEA
KGPYIYELFSIMIHSGSASGGHYYAYIKDFRTDKWLCFNDQIVTPITQDEIQKTYGGGNR
PGYFSGAYRSSTNAYMLMYRQIDPKRNALPMQADDFPPHIKELLEKMKKSEEERNCYIDE
PSFVDRRYNRPIYYRHPATGEVKEVFVSFRMSMTLRQIAEATYKEANLDSLVDFEQCRIV
NYLPRYDLIECSYEDCDHTKLEDLFDYTRMNLLLDIRPKSEQFESYLPMPIITKVYVIDA
LDTNIVDGPKYIRANQKQTIQEFKQELKKHFNLDPNTVQLLCQEIQQNKLLDDDLVLESK
YSGHLFKIGATDSYEHEMLMNLEESVFFKMCEYLDDIVTFYVDTSKVTKEQLVKQGIPTL
DEYYKEEKTQENTNSLFNCVTDEISKFNISSSYNNSAKNHSQIAPNSDMTDVYEMILQNK
GAIDKEECKVQETSNSEDSSLSDSDRTLVGDVPEESELDCESALNPADRFTGSHFYPNSL
INQNNESELVKYFKISTVKNQKLLKISVDYRIKEDELKEKLESSLNIPKDYFKLTEFVAE
DACSYSSSRNKLVLKEDQKYSICLGRICNSNELKLDVYRLDMQSMLPLARLSTLYVNKTT
TVGNVKKQIRAELKRKNILDLQDGKWLFVDYNEEILGDVWSNDENRLHSTDGICLCPSDS
PICVKKWNRKDMQLENPEPISVTGDNINIKLKETISSMSKIPLECLELCPMVVGKQSALD
KIETFKWISDINNDEIDCKTYILYRDSRETPKILTEEEKNNMRRNAISRQDRYNLPPTPM
TSSPRREKALKIHVDPS
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagtaaaatatgtttatttcacatctcaatctaaccattcaggtattttggag
agaactgcacctgcaaagtatgttaaaacggcaaaagtactgagtgacgtaataatacaa
agaattgaaaatacaggttgtaaatataaagacatttgtatattgaaattaaaacttcct
aatgataaagaacaagatataactgcaagcatgttcagtcctgccaatcttgaaaatgtt
cttgaagaggtaatacgtactttacctccagaagatgaaacaccttcactgcagttatca
atggaatggtacaaagaacatagaggagtaagagtacctaagaatgtttctagacctgta
aaacctgcaacgaagtataagtcttgcactgaaagttatgataatagttcaaagatttta
tgcaatgataccgaaactttaaaacctaattatgtgggtttagtgaatcaagcaatgaca
tgctatctcaatagtcttctacaagcattgtacatgactcctgaatttagaaatgctttg
tataattgggagtacaaaagttcagaaaagaacacaactaatagcagcacaactagcaat
agtattccatatcagctacaaaaattgtttctcaatctgcagacatcacaaaaaactgct
gttgaaacgacttcgttaactaaaagttttggttggaattcaaatgacgcatggcaccaa
catgacattcaagaattgtgcagagtgatgtttgatgcactggagcttacatttacaaat
acagctcaggctgatcttattaacagactttatgaaggtaaaataaatgattatgtaaag
tgcctaacatgtaacacagaaaagtttagagaagatactttccttgatattccgttacct
gtaagaccttttgatactaatgtagcatatggtagtgtggaagaagcattggaagcattt
gtaaagtacgaaactctagaaggaaataatcaatatttttgtgaaaaatgtgacaaaaag
tcgaacgctcataaaggactgaaattcaccaaatttccatacattttaacattacagtta
aaacgatttgattttgatcaaaatacatatcacagaataaaattaaatgataaagtaaca
tttcctgatgtcttgaatttgaacacctttattgaatcatcatcaaataaggaatcccct
ttgaatgaagaagatgctggcatgagtgtaaaatgtgatgatagtattactacagacagc
agtactatggacgagacagagtatgcttcaagtgatataattctgtcaaatagtaatcac
ttgagtaatcccgatcaagatgatgatgaaggcattgatgtaagcaatggtatgtcgtct
tcgtcatctagtatgcacaataacaacgccgaaaaaatacgtgaggattatgcagaagca
aaaggaccgtacatttatgagcttttttccattatgatccacagtggcagtgcaagtggt
ggtcactactatgcttatataaaagacttccgaactgacaaatggctgtgttttaatgat
cagattgttacacctataactcaggacgaaattcaaaaaacatatggaggtggtaatagg
ccaggatattttagtggagcatatagaagtagtacaaatgcatatatgctaatgtacaga
caaatagatccaaaacgtaatgctttacctatgcaagccgacgattttcctcctcatatt
aaggaacttctagaaaagatgaaaaaaagtgaggaagaacgaaattgttatattgatgaa
ccaagttttgtggatagacgttataacaggcctatttactatcgacatccagcaaccggt
gaagtcaaagaagtttttgtttcatttagaatgagtatgacactgcgtcagattgcggaa
gcgacttacaaagaggctaatcttgacagtcttgttgattttgagcaatgccgcatagtc
aactatttacctcgttacgatttaattgaatgctcttatgaagattgtgatcacacgaaa
ctcgaagatttgtttgactataccagaatgaacctgctacttgatatacgtccaaagtct
gaacaatttgaatcttaccttcctatgccaatcattacaaaggtttacgtgattgacgct
ttggacacaaatattgttgacggaccaaaatacatacgtgctaatcaaaaacaaaccatt
caggaattcaaacaggaacttaagaaacactttaacttagatccaaatactgtgcaacta
ctttgtcaagaaatacagcaaaataaattgctggatgatgatttggtgcttgaatcaaaa
tattcagggcatctttttaagattggcgctactgattcttatgaacatgagatgctgatg
aatcttgaagaatcagtgttctttaaaatgtgtgaatacttggatgatattgtgactttt
tatgtagatacaagcaaagtcaccaaagaacaactagtaaaacaaggtataccaactctt
gacgaatattataaagaagaaaaaacacaagaaaacactaatagtctatttaattgtgtt
acggatgaaatatcaaaatttaatatttcatcttcatataacaactctgccaaaaatcat
tcacaaatcgctccaaattctgacatgacagatgtttacgaaatgattttgcaaaataaa
ggagctattgataaggaagaatgcaaagttcaagaaacaagtaatagtgaggatagcagt
ttgagtgatagtgatagaacgttagtaggggatgtacccgaagaatctgaattagattgt
gaatcggctcttaatccggcagatagatttacaggaagtcacttttatccgaattcacta
ataaatcagaataatgagagtgaacttgtaaaatattttaagatttcaactgtaaaaaat
caaaagttattgaaaatatcagtggattacaggattaaagaagatgaattaaaagagaaa
ctagaatcaagtttaaatattcccaaggattattttaaattaacagaattcgtagcggaa
gatgcatgctcatatagctcgtctcggaataaactggtattaaaagaagaccaaaagtat
tcgatttgtttaggacgaatatgcaattccaacgaattaaaactggatgtatataggtta
gacatgcaaagcatgttgccattagcgagattgtcaactctgtatgtcaacaaaactacg
accgttggaaatgttaagaaacaaatacgagctgagttgaaaagaaaaaatattttagat
ttgcaagatggaaagtggctgtttgtagactacaatgaggaaatattgggcgatgtctgg
agtaatgacgaaaatcgcttacattctacagatggaatctgcttatgccctagcgattcg
ccgatctgcgtcaaaaaatggaatcgtaaggatatgcaattagaaaatccggaaccaatt
tctgttactggtgacaatataaacataaaactgaaagaaactatatcatccatgtcgaaa
atcccacttgagtgcctggaattatgtccaatggttgttgggaaacagtctgctttagat
aaaatagagacgtttaaatggatatcagatataaataacgatgaaatagattgcaaaacc
tacatactgtacagagattcgagagagacgccaaaaatactcacggaggaagaaaagaac
aatatgcggcggaatgcaataagtcggcaggatcgctacaacttgccgccaactccgatg
acctccagtccacgaagggaaaaagcgcttaaaatacacgtggatccgtcatga

DBGET integrated database retrieval system