KEGG   Nasonia vitripennis (jewel wasp): 100114408Help
Entry
100114408         CDS       T01081                                 

Definition
uncharacterized LOC100114408
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 823 aa AA seqDB search
MPFHQSGHVDAVALSYSSSAMAPLSPSISRRYSSNASSSSSSSSLSSTPKYNSYRASAAS
SIHDRPSYRTNDYSSKTSYNLPRLQPSSSYSDSTHRYTGTSGRGSSSSSSSGVGSNGLSS
LSTSFDLSKYSPHHYVPNIQRSNASSSSLLQHSHLHSSGSVGGSSAGSLASSTSSGSLHS
SAADLLGGDEASGRSHREASISSSSGSSPSSQLWSTKQRRGDEVTGCCTDQRNNNNNNNN
SPAGGARLAQLDNNNSTDSDDLTEPKPLLLAPPPPLPAGFSAGCGKRGSQTAASATSSTS
PTTATTATTATTAATAATATATSTSAGSGCSSFSPPSNPSANNTEQQQQPLATNNNASSR
YHSSAAGIAGGISRTTTMLAAATGESLAVVSQAADRPTLNGETNSSPYFATSGSGADQSG
LENSAAAAASDNLEAGSVGPLGGQASSDSNSSSECSTSGGSSGGRSNGGRSRLQGTRDER
CGLNGLRNIGNTCFMNSVIQCLSNTRPLLEYLLNEQYLTDINTTTSSMKGALIKAFSQVI
QELWENDGDHVVNTSSLKSQIQRFAPRFMGYSQQDAQEFLRYLLEGLHEDVNRVTVKPQP
IHTDIPDSYSDSMKAAESWKRYLRSEDSTIVDVFVGQLRSSLRCTVCDHVSVTLDPFWDL
SLPIPSRSGTVRLNQCLEHFTREEVLDGDEKPTCSKCQMRRKCTKSFAIQKFPKILVIHL
KRFSPMERFRGKLSVLVDFPLTGLELSAFAAPRVQGCTYNLYGVANHSGTTHSGHYTAYC
KHPYSGEWHEYNDSRVTPVSARSVVSSEAYVLFYEQQPHSSHL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccaccagagcggacacgtcgacgcggtcgccctgagctacagtagcagcgcc
atggcgcccctatcgcccagcatctctcgacgctactcgagcaacgcgagctcgagctcg
agctcctcgagcctcagtagcacccccaagtacaactcgtatcgagccagtgctgccagc
tccatccatgaccggccgagctacaggaccaacgattactcgtcgaaaacgtcctacaac
ctgcctaggttgcagccgtcgtcctcgtactcagactcgacgcaccgctacaccggcacg
tcgggacgaggcagcagcagcagcagcagcagcggcgtcggcagcaacggcttgagcagc
ctctcgacgagcttcgacctgagcaagtactcgccccaccactacgtgcccaacatccag
cgcagcaacgcgagcagctcgagcctgctccagcacagccacctgcacagcagcggcagc
gtcgggggcagcagcgccggcagcctcgcctccagcacctccagtggcagcctccactcc
tcggcggccgacctcctcggcggcgacgaggccagcgggcgcagccaccgcgaggcctcc
atctcttcctcgagcggctcgtcgcccagcagccagctctggagcaccaagcagcgccgc
ggcgacgaggtaaccggctgctgcaccgaccagcgcaacaacaacaataacaacaacaac
agccccgccggcggcgccagacttgcgcaactcgacaacaacaactcgaccgacagcgac
gacttgaccgagccaaagccgctactgctggcaccgccgccgccgctgccagctggcttc
tccgcgggctgcggcaaacggggcagccagacagcggcgtcagctaccagtagcactagt
cccaccaccgccaccaccgccaccaccgccaccaccgccgccaccgccgccaccgccacc
gccacctccacctccgccggcagcggctgctcgtcattctccccgccctctaacccctcg
gctaataacaccgagcagcagcagcagccgctcgctactaacaacaatgcgagcagccgt
taccactcgtccgcagctggcatcgctggcggcatcagtaggaccacgacgatgctcgcc
gccgcgaccggggagagcctcgccgtcgtgagccaggccgccgaccggcccactctcaac
ggcgagaccaactcctccccctacttcgctaccagcggcagcggcgccgaccagagcgga
ctggagaacagcgcagcggcggccgcctcggacaacctggaagccggcagcgtcggcccc
ctcggcggacaggcctcctcggacagcaactcctcgagcgaatgcagcacaagtggcggc
agcagtggcggcagatcgaacggcggcaggagccgtctgcagggcacgcgcgacgagcgc
tgcggcctcaatggcctgcgaaacatcggaaacacgtgtttcatgaacagcgtaatacaa
tgcctgagcaatacgcggccgctgttggagtacttgctgaacgagcagtacctgaccgac
ataaacacgacgacgtcgagtatgaagggtgccctgatcaaggctttcagccaggtgatc
caggagctctgggagaacgacggcgaccacgtcgtcaacacctcctcgctcaagtcccag
atccagagattcgcgccgcgattcatgggctacagtcagcaggacgcgcaggagttcctg
cgatacctgctcgagggtctgcacgaggacgtcaaccgagtcactgtcaagccacaaccc
attcacaccgacatacctgacagttattcggacagtatgaaggcggcggaaagctggaag
cgctacctacgcagtgaggacagcacgatagtagacgtgttcgtcgggcagctgagatcg
tcgctgcgctgtacagtctgcgaccacgtgtccgtgactctcgatccgttctgggatctc
agtttgccgattccctcgcggagcggcaccgtcaggctcaaccagtgtcttgagcacttc
accagggaggaggtgctcgacggcgacgagaaacctacttgctccaagtgccagatgagg
agaaagtgcaccaagagcttcgccatacagaaattcccgaagattttggttattcatttg
aaacggttctcaccgatggagcgattccgcggcaaattaagcgtgttagtggacttcccg
ctgacgggtctggagcttagtgctttcgcggctccccgagttcaaggctgcacatacaac
ctgtacggcgtggcgaatcactcgggtacgacgcactccggccactacaccgcctactgc
aagcatccctactccggcgagtggcacgagtacaacgacagcagggtcaccccagtttcc
gcgcgatcggtcgtctccagcgaggcctacgttctcttctacgagcagcaaccccacagc
tcgcacctctaa

DBGET integrated database retrieval system