KEGG   Nasonia vitripennis (jewel wasp): 100114440Help
Entry
100114440         CDS       T01081                                 

Gene name
P38mapk
Definition
(RefSeq) p38 map kinase
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04013  MAPK signaling pathway - fly
nvi04068  FoxO signaling pathway
nvi04624  Toll and Imd signaling pathway
nvi04933  AGE-RAGE signaling pathway in diabetic complications
Module
nvi_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100114440 (P38mapk)
   04068 FoxO signaling pathway
    100114440 (P38mapk)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    100114440 (P38mapk)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100114440 (P38mapk)
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100114440 (P38mapk)
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100114440 (P38mapk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 100114440
NCBI-ProteinID: NP_001136337
NASONIABASE: NV50013
Position
1
AA seq 356 aa AA seqDB search
MPQFHKLEINKTEWEVPERYQMLTPVGSGAYGQVCSALDTTSGCKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENVIGLLDVFHPSTSLEDFQHVYLVTHLMGADLNNIVRTQKLSD
DHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPRD
EFMQKISSESARNYIQSLPPLKKKNFKEVFRGANPLAIELLELMLELDAEKRITAEQALA
HPYLAQYADPTDEPVSLPYDQSFEDMELPVEKWKELVYHEVVNFVPQQQMLPADTA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagttccacaaacttgaaataaacaagacagaatgggaagttccagagaggtat
cagatgctgactcctgttggatcaggtgcttatggccaagtttgctctgctttagacaca
actagtggttgcaaggtagccataaaaaaattggcaagaccatttcagtccgctgtccac
gcaaaacgtacttacagagagctcagaatgcttaaacatatgaaccatgaaaatgtgata
ggtttgttggacgtatttcatccaagcacgtctcttgaagattttcaacatgtatacctg
gtaacacatcttatgggtgctgacttaaataacattgttagaactcagaaactttccgat
gaccatgtccaattccttgtttatcaaatactcagaggtttaaaatacattcattcagct
ggaatcattcatagggatctaaaaccttcaaacatagcagtaaatgaagattgtgaattg
aaaattttagactttggtttggctagacctacagaaaatgaaatgactggttacgtagca
acaagatggtatagggcaccagaaatcatgctcaactggatgcactataatcaaacagtt
gacatttggtctgttggatgcattatggccgagttgttgacgggaagaacattattccca
ggaacagatcatattcaccaattaaaccttattatggaagtattgggcactccacgagac
gagtttatgcagaaaatatcgtccgagtcggcgagaaattacatacagagcttaccgcct
ttgaagaagaagaacttcaaagaagttttccgaggagctaatccgttggccattgaatta
ttggaattgatgctggagttggacgccgagaaaaggataacggctgaacaagctctggcc
cacccatatctcgctcaatacgccgaccctacagacgagcccgtctccttgccctacgat
caaagcttcgaagatatggaattaccggtcgaaaagtggaaagaactagtctaccacgaa
gtcgtaaactttgtacctcagcagcaaatgctaccagcggacaccgcctga

DBGET integrated database retrieval system