KEGG   Nasonia vitripennis (jewel wasp): 100114493Help
Entry
100114493         CDS       T01081                                 

Gene name
HSC70
Definition
heat shock cognate 70
Orthology
K03283  
heat shock 70kDa protein 1/8
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Spliceosome
Protein processing in endoplasmic reticulum
Endocytosis
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:nvi03040]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nvi04141]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:nvi04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 655 aa AA seqDB search
MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPNNTIFDAKRLIGRRFEDATVQADMKHWPFNVISDGGKPKIQVQYKGETKTFFPEEVS
SMVLVKMKETAEAYLGMTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLTANKRALRRLRTSCERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELCADLFRGTLEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTI
PTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEKQKETISAKN
GLESYCFNMKSTVEDEKIKDKISSSDKQVVLDKCNEIIKWLDANQLADKEEYEHKQKELE
SICNPIVTNLYQGAGGGMPGGMPGGFPGAGGAPGAGGAAPGGAGGAAGPTIEEVD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcacccgcagtcggtattgatctgggtacgacgtactcctgcgtcggagtc
ttccagcatggaaaggtcgaaatcatcgccaacgaccagggtaaccgcaccacccccagt
tacgtggccttcaccgacaccgagcgtctcatcggtgatgccgccaagaaccaggttgcc
atgaaccccaacaacaccatcttcgatgccaaacgccttatcggtcgtcgtttcgaggat
gccaccgtccaggctgacatgaagcactggccattcaatgtcatcagcgacggcggcaag
ccaaagatccaagttcagtataaaggagaaacgaagactttcttccccgaagaagtgagt
tcgatggtccttgtcaagatgaaggaaaccgctgaggcttacctcggtatgaccgtcacc
aatgccgtgatcaccgtgcccgcttacttcaacgactcgcagcgtcaggcaaccaaggac
gccggtaccatctcgggcctgaacgtgctgcgtatcatcaacgagcccaccgccgccgct
atcgcctacggtctcgacaagaaggccgtcggtgagcgtaacgttctcatcttcgatctt
ggcggcggtaccttcgacgtctccatcctgaccatcgaggatggtatcttcgaggtcaag
tcaacggccggtgacactcacttgggaggtgaggacttcgacaaccgtatggtcaaccac
ttcgtccaggagttcaagcgcaagtacaagaaggaccttaccgccaacaagcgtgccctt
cgtcgtctgcgcacgagctgcgagcgtgcgaagcgtactctctcctcgtcgacccaggcc
agcattgaaatcgactctctctacgagggtatcgacttctacacctccatcaccagggct
cgtttcgaggagctctgcgctgacctcttcagaggcaccctcgagcccgtcgagaagtcc
ctgcgtgacgccaagatggacaaggcccagatccacgacatcgtcctcgtcggtggatcc
acccgtatccccaagatccagaagctcctccaagacttcttcaacggcaaggaactcaac
aagtccatcaaccctgatgaggctgtggcttacggagctgccgttcaggccgccatcttg
cacggtgacaagtccgaggaggtccaagatctcctgcttctcgacgtcactcccctgtct
cttggtatcgagactgctggaggtgttatgaccgctctcatcaagagaaacaccaccatc
ccgaccaagcagacccagaccttcaccacctacgccgacaaccagcctggtgtactcatt
caggtctacgaaggtgagcgtgccatgaccaaggacaacaacctccttggaaagttcgag
ctcagtggaattcccccagcgccccgtggtgttccccagatcgaagttaccttcgacatt
gacgccaacggtatcttgaacgtctctgctgtcgacaagtcgactggcaaggagaacaag
atcaccatcaccaacgacaagggacgtctcagcaaggaagacattgagcgtatggtcaat
gaggccgagaagtacaggagcgaagacgagaagcagaaggagaccatctctgccaagaac
ggtctggagtcttactgcttcaacatgaagagcaccgtcgaagacgagaaaatcaaggac
aagattagctctagcgacaagcaggtcgttctcgacaaatgcaacgagatcatcaagtgg
ctcgacgccaaccagctggctgacaaggaggaatacgaacacaagcagaaggaactggag
tccatctgcaaccccattgtcacaaatctgtaccagggcgccggtggcggtatgcccggt
ggaatgccaggtggcttccccggtgccggtggcgctccaggagccggtggtgccgcacca
ggtggtgctggaggagctgctggccccaccatcgaagaggtcgactaa

DBGET integrated database retrieval system