KEGG   Nasonia vitripennis (jewel wasp): 100114493Help
Entry
100114493         CDS       T01081                                 

Gene name
HSC70
Definition
heat shock cognate 70
Orthology
K03283  
heat shock 70kDa protein 1/8
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Spliceosome
Protein processing in endoplasmic reticulum
Endocytosis
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    100114493 (HSC70)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100114493 (HSC70)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100114493 (HSC70)
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100114493 (HSC70)
Spliceosome [BR:nvi03041]
 Complex B
  Other components
   Prp19 complex
    100114493 (HSC70)
 Complex C
   Prp19-CDC5 complex
    100114493 (HSC70)
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100114493 (HSC70)
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100114493 (HSC70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 655 aa AA seqDB search
MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPNNTIFDAKRLIGRRFEDATVQADMKHWPFNVISDGGKPKIQVQYKGETKTFFPEEVS
SMVLVKMKETAEAYLGMTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLTANKRALRRLRTSCERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELCADLFRGTLEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTI
PTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEKQKETISAKN
GLESYCFNMKSTVEDEKIKDKISSSDKQVVLDKCNEIIKWLDANQLADKEEYEHKQKELE
SICNPIVTNLYQGAGGGMPGGMPGGFPGAGGAPGAGGAAPGGAGGAAGPTIEEVD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcacccgcagtcggtattgatctgggtacgacgtactcctgcgtcggagtc
ttccagcatggaaaggtcgaaatcatcgccaacgaccagggtaaccgcaccacccccagt
tacgtggccttcaccgacaccgagcgtctcatcggtgatgccgccaagaaccaggttgcc
atgaaccccaacaacaccatcttcgatgccaaacgccttatcggtcgtcgtttcgaggat
gccaccgtccaggctgacatgaagcactggccattcaatgtcatcagcgacggcggcaag
ccaaagatccaagttcagtataaaggagaaacgaagactttcttccccgaagaagtgagt
tcgatggtccttgtcaagatgaaggaaaccgctgaggcttacctcggtatgaccgtcacc
aatgccgtgatcaccgtgcccgcttacttcaacgactcgcagcgtcaggcaaccaaggac
gccggtaccatctcgggcctgaacgtgctgcgtatcatcaacgagcccaccgccgccgct
atcgcctacggtctcgacaagaaggccgtcggtgagcgtaacgttctcatcttcgatctt
ggcggcggtaccttcgacgtctccatcctgaccatcgaggatggtatcttcgaggtcaag
tcaacggccggtgacactcacttgggaggtgaggacttcgacaaccgtatggtcaaccac
ttcgtccaggagttcaagcgcaagtacaagaaggaccttaccgccaacaagcgtgccctt
cgtcgtctgcgcacgagctgcgagcgtgcgaagcgtactctctcctcgtcgacccaggcc
agcattgaaatcgactctctctacgagggtatcgacttctacacctccatcaccagggct
cgtttcgaggagctctgcgctgacctcttcagaggcaccctcgagcccgtcgagaagtcc
ctgcgtgacgccaagatggacaaggcccagatccacgacatcgtcctcgtcggtggatcc
acccgtatccccaagatccagaagctcctccaagacttcttcaacggcaaggaactcaac
aagtccatcaaccctgatgaggctgtggcttacggagctgccgttcaggccgccatcttg
cacggtgacaagtccgaggaggtccaagatctcctgcttctcgacgtcactcccctgtct
cttggtatcgagactgctggaggtgttatgaccgctctcatcaagagaaacaccaccatc
ccgaccaagcagacccagaccttcaccacctacgccgacaaccagcctggtgtactcatt
caggtctacgaaggtgagcgtgccatgaccaaggacaacaacctccttggaaagttcgag
ctcagtggaattcccccagcgccccgtggtgttccccagatcgaagttaccttcgacatt
gacgccaacggtatcttgaacgtctctgctgtcgacaagtcgactggcaaggagaacaag
atcaccatcaccaacgacaagggacgtctcagcaaggaagacattgagcgtatggtcaat
gaggccgagaagtacaggagcgaagacgagaagcagaaggagaccatctctgccaagaac
ggtctggagtcttactgcttcaacatgaagagcaccgtcgaagacgagaaaatcaaggac
aagattagctctagcgacaagcaggtcgttctcgacaaatgcaacgagatcatcaagtgg
ctcgacgccaaccagctggctgacaaggaggaatacgaacacaagcagaaggaactggag
tccatctgcaaccccattgtcacaaatctgtaccagggcgccggtggcggtatgcccggt
ggaatgccaggtggcttccccggtgccggtggcgctccaggagccggtggtgccgcacca
ggtggtgctggaggagctgctggccccaccatcgaagaggtcgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system