KEGG   Nasonia vitripennis (jewel wasp): 100114667Help
Entry
100114667         CDS       T01081                                 

Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100114667
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100114667
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100114667
  Exosomal proteins of colorectal cancer cells
   100114667
  Exosomal proteins of bladder cancer cells
   100114667
Heparan sulfate/heparin binding proteins [BR:nvi00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100114667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1009 aa AA seqDB search
MDDKFAITVDHVKSRKKPTNSIETFFAAESFNAKSKLVAMIDRRSKRIILETVQDNQPRR
EHIVADSLDISEPFRNLVLIVDQRAQKVQVYVDCKLQGEIALRRSLKQMAQHAGDLPLEV
FRERRYRTRIYGSGEIEQALHREDCPSTTLYDLEVPEDSRQLHGNQSTRVRRRGDIPGDI
PALVDPNGCYTDELMAKTLNQLIDAIRKMWTKLDLNLLETKRIRELLENCAACQEKPTPP
PPPPRSCRYNSPCFPNAECRDTPSGPQCLRCPSGYYGDGRNCRRYPGCSDGPCFEGVDCM
DTATGFTCGPCPRGYTGNGQHCERINACQPNPCFPNVPCNPTHVPPYFRCGHCPAGYHGN
GVSCSREDECDLAKPCWQGVRCHKYESGYRCDPCPEGMSGNSSSGRGVEYALTHKQFCYK
IDPCSDNNGGCVENSDCINSEGTARCGACKAGFVGDQTVGCHPSHEVCPDGVMRCDRHAD
CICVAVNQYSCRCNVGWAGDGLICGVDSDSDGYPDERLNCQDLRCRADNCPKTPNSGQED
ADGDGMGNACDEDADNDGVLNLSDNCPLLANSDQADSDQEGPDDVGDVCDNCPYVKNRDQ
HDTDGDGIGDACDNDMDNDGVPNNEDNCAKTWNEDQQDTDHDGIGDVCDNCPRQHNPDQA
DEDGDRVGDVCDNNHDRDKDGIQDDIDNCKNDPNPSQTDSDNDGIGDECDEDADNDDRLN
HEDNCPYVHNPDQADLNGDGIGDACFDDNDNDKVGNLIDICPNNSRVWATDFRKYDTIAL
DPYGKTQEDPIWEIHHNGSEIYQTMNSDPGIAVGLDSFSGVDFEGTFFVNTDIDDDYVGF
VFSYQNTRQFYTVMWKKVLQTYWEPKPFRAVAETGIQLKLVDSKTGPGEIMRNSLWHTGN
TRDQVKLLWKDPRKVGWKQYTSYRWRLIHRPRIGLIRLWIYEGQRLIADSGNNFDSTLKG
GRLGVFAFSQQMVLWSNLKYTCKETVPYEVYRTLPPNIQPLVHTDYNRP
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaagttcgccatcaccgtggaccacgtgaaatcccgtaagaagccgaccaac
tccatcgagacgttcttcgccgcggagtccttcaacgccaagtcgaaactcgtcgccatg
atcgacaggcgatcgaagcgaataatcctggagacggtccaggacaaccagccgcgtcgc
gaacacatcgtcgccgacagtctggacatatccgagcccttcaggaacctcgtccttatc
gtggaccagcgagcccagaaggtccaggtctacgtcgactgcaagctgcagggcgagatc
gcgctgaggaggagcctcaaacaaatggctcaacacgccggtgatctgcccctcgaagtg
ttccgggagcgcagatacaggacgaggatttatggaagcggcgagatcgagcaggctctg
caccgcgaggactgccccagcacgacgctctacgacctcgaggtgccggaggactcgcgc
caactgcacggcaaccagagcacgagggtcaggaggaggggcgatattcccggcgacatt
cccgccctcgtcgatcccaacggctgctacacggacgagctcatggccaagacgctgaat
cagctcatcgacgcgatcaggaagatgtggaccaagctcgatctgaacctgctcgagacc
aagcgcatccgggagctgctggagaactgcgcggcctgccaggagaaaccgacaccgcca
ccgccgcctccacgaagctgtcggtacaactcgccgtgcttcccgaacgccgagtgccgt
gacacccccagcggtccccagtgtctgcgctgtccctctggctattacggcgacgggcgc
aattgccgcagatatcccggctgcagcgacggcccctgcttcgagggcgtcgactgcatg
gacaccgccaccggattcacctgcggcccgtgtccgcgcggctacaccggcaacgggcag
cactgcgagcgcatcaacgcctgccagccgaatccctgcttcccgaacgtaccctgcaat
ccgacccacgtgccgccgtacttccgatgcggccactgtcctgccggatatcacggcaac
ggagtcagctgcagccgcgaggacgagtgcgatcttgccaagccctgctggcagggagtc
aggtgccacaagtacgagagcggatacagatgcgacccctgccccgaaggcatgagcggc
aacagctcctcgggacgcggcgtcgagtacgccctgacgcacaagcagttctgctacaag
atcgacccttgcagcgacaacaacggcggctgcgtcgagaactcggactgcatcaactcc
gaggggacagctagatgtggcgcgtgcaaagccggttttgtcggcgatcagacggtaggc
tgccatcccagtcacgaagtctgtccggatggagtcatgagatgcgaccgacacgccgac
tgtatctgcgtcgcagtcaaccagtattcctgcaggtgcaacgtcggctgggccggcgac
ggtctgatctgcggcgtagactcggacagcgacggctaccccgacgagcggctcaactgc
caagacctgcgttgccgagccgacaactgcccgaagacgcccaacagcggccaggaagat
gccgacggcgacggcatgggaaacgcctgcgacgaggacgccgacaacgacggagtgctc
aatctgtcggacaactgtcctctgctggccaacagcgaccaggcggacagcgaccaagag
ggtcccgacgacgtaggggacgtctgcgacaactgtccctacgtgaagaacagagatcag
cacgacactgacggagacggcatcggcgacgcctgcgacaacgacatggacaacgatggt
gtgccgaacaacgaggacaactgcgcgaagacctggaacgaggaccagcaagacaccgac
cacgacggcatcggcgacgtctgcgacaactgcccgcgccagcacaatcccgaccaggcc
gacgaggacggcgatcgcgtgggcgacgtctgcgacaacaaccacgaccgggacaaggac
ggcatccaggacgacatcgacaactgcaagaacgatccgaatcccagtcagaccgactcg
gacaacgacggcatcggcgacgagtgcgacgaggacgccgacaacgacgaccggctcaac
cacgaggacaactgcccctacgtgcacaatcccgatcaggcggatctcaatggtgacgga
atcggcgacgcttgcttcgatgacaacgataacgataaggtcggaaacctcatcgacatc
tgcccgaacaacagccgagtctgggctacagatttccgaaaatacgacaccatcgctctt
gacccctacggcaagacccaagaagatccaatctgggagattcaccataatggctccgaa
atttatcagacgatgaatagcgatcctggaattgccgtcggcttggacagcttcagcggc
gtcgatttcgagggtacgttcttcgtcaacacggatatcgacgacgattacgtgggcttc
gtcttctcctatcaaaacactcggcagttctacacggtcatgtggaaaaaggtgctgcag
acatactgggagccgaaacccttccgggccgtcgctgaaactggcatccaattgaagctc
gtcgactccaagaccggacccggtgaaatcatgcgcaacagcctctggcatacgggcaac
acgcgcgatcaggtgaaactgctgtggaaggatccgcgaaaggtcggctggaagcagtac
acgtcctacaggtggcgattgattcacaggccgaggatcggtttgatccgtctctggatc
tacgaaggccagaggctcatcgccgactctggcaataactttgactcgaccctcaaaggc
ggcagactcggagtcttcgctttctcccagcaaatggtgctctggtcgaatctcaagtac
acgtgtaaagagaccgtgccttacgaggtgtatcggacgctgcccccgaacatacagcca
ctcgtccacaccgactacaatcgtccgtga

DBGET integrated database retrieval system