KEGG   Nasonia vitripennis (jewel wasp): 100114667Help
Entry
100114667         CDS       T01081                                 

Definition
thrombospondin-3-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Phagosome
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:nvi04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:nvi04145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1044 aa AA seqDB search
MRGVATIVLFVALATISSSSLAPDEGLTKTLEKVLMDDKFAITVDHVKSRKKPTNSIETF
FAAESFNAKSKLVAMIDRRSKRIILETVQDNQPRREHIVADSLDISEPFRNLVLIVDQRA
QKVQVYVDCKLQGEIALRRSLKQMAQHAGDLPLEVFRERRYRTRIYGSGEIEQALHREDC
PSTTLYDLEVPEDSRQLHGNQSTRVRRRGDIPGDIPALVDPNGCYTDELMAKTLNQLIDA
IRKMWTKLDLNLLETKRIRELLENCAACQEKPTPPPPPPRSCRYNSPCFPNAECRDTPSG
PQCLRCPSGYYGDGRNCRRYPGCSDGPCFEGVDCMDTATGFTCGPCPRGYTGNGQHCERI
NACQPNPCFPNVPCNPTHVPPYFRCGHCPAGYHGNGVSCSREDECDLAKPCWQGVRCHKY
ESGYRCDPCPEGMSGNSSSGRGVEYALTHKQFCYKIDPCSDNNGGCVENSDCINSEGTAR
CGACKAGFVGDQTVGCHPSHEVCPDGVMRCDRHADCICVAVNQYSCRCNVGWAGDGLICG
VDSDSDGYPDERLNCQDLRCRADNCPKTPNSGQEDADGDGMGNACDEDADNDGVLNLSDN
CPLLANSDQADSDQEGPDDVGDVCDNCPYVKNRDQHDTDGDGIGDACDNDMDNDGVPNNE
DNCAKTWNEDQQDTDHDGIGDVCDNCPRQHNPDQADEDGDRVGDVCDNNHDRDKDGIQDD
IDNCKNDPNPSQTDSDNDGIGDECDEDADNDDRLNHEDNCPYVHNPDQADLNGDGIGDAC
FDDNDNDKVGNLIDICPNNSRVWATDFRKYDTIALDPYGKTQEDPIWEIHHNGSEIYQTM
NSDPGIAVGLDSFSGVDFEGTFFVNTDIDDDYVGFVFSYQNTRQFYTVMWKKVLQTYWEP
KPFRAVAETGIQLKLVDSKTGPGEIMRNSLWHTGNTRDQVKLLWKDPRKVGWKQYTSYRW
RLIHRPRIGLIRLWIYEGQRLIADSGNNFDSTLKGGRLGVFAFSQQMVLWSNLKYTCKET
VPYEVYRTLPPNIQPLVHTDYNRP
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcgtcgctacgatcgtgctcttcgtggcgctcgccactatttctagctcgagc
ctcgcgcccgacgagggtttaaccaaaactctggagaaggtcttgatggacgacaagttc
gccatcaccgtggaccacgtgaaatcccgtaagaagccgaccaactccatcgagacgttc
ttcgccgcggagtccttcaacgccaagtcgaaactcgtcgccatgatcgacaggcgatcg
aagcgaataatcctggagacggtccaggacaaccagccgcgtcgcgaacacatcgtcgcc
gacagtctggacatatccgagcccttcaggaacctcgtccttatcgtggaccagcgagcc
cagaaggtccaggtctacgtcgactgcaagctgcagggcgagatcgcgctgaggaggagc
ctcaaacaaatggctcaacacgccggtgatctgcccctcgaagtgttccgggagcgcaga
tacaggacgaggatttatggaagcggcgagatcgagcaggctctgcaccgcgaggactgc
cccagcacgacgctctacgacctcgaggtgccggaggactcgcgccaactgcacggcaac
cagagcacgagggtcaggaggaggggcgatattcccggcgacattcccgccctcgtcgat
cccaacggctgctacacggacgagctcatggccaagacgctgaatcagctcatcgacgcg
atcaggaagatgtggaccaagctcgatctgaacctgctcgagaccaagcgcatccgggag
ctgctggagaactgcgcggcctgccaggagaaaccgacaccgccaccgccgcctccacga
agctgtcggtacaactcgccgtgcttcccgaacgccgagtgccgtgacacccccagcggt
ccccagtgtctgcgctgtccctctggctattacggcgacgggcgcaattgccgcagatat
cccggctgcagcgacggcccctgcttcgagggcgtcgactgcatggacaccgccaccgga
ttcacctgcggcccgtgtccgcgcggctacaccggcaacgggcagcactgcgagcgcatc
aacgcctgccagccgaatccctgcttcccgaacgtaccctgcaatccgacccacgtgccg
ccgtacttccgatgcggccactgtcctgccggatatcacggcaacggagtcagctgcagc
cgcgaggacgagtgcgatcttgccaagccctgctggcagggagtcaggtgccacaagtac
gagagcggatacagatgcgacccctgccccgaaggcatgagcggcaacagctcctcggga
cgcggcgtcgagtacgccctgacgcacaagcagttctgctacaagatcgacccttgcagc
gacaacaacggcggctgcgtcgagaactcggactgcatcaactccgaggggacagctaga
tgtggcgcgtgcaaagccggttttgtcggcgatcagacggtaggctgccatcccagtcac
gaagtctgtccggatggagtcatgagatgcgaccgacacgccgactgtatctgcgtcgca
gtcaaccagtattcctgcaggtgcaacgtcggctgggccggcgacggtctgatctgcggc
gtagactcggacagcgacggctaccccgacgagcggctcaactgccaagacctgcgttgc
cgagccgacaactgcccgaagacgcccaacagcggccaggaagatgccgacggcgacggc
atgggaaacgcctgcgacgaggacgccgacaacgacggagtgctcaatctgtcggacaac
tgtcctctgctggccaacagcgaccaggcggacagcgaccaagagggtcccgacgacgta
ggggacgtctgcgacaactgtccctacgtgaagaacagagatcagcacgacactgacgga
gacggcatcggcgacgcctgcgacaacgacatggacaacgatggtgtgccgaacaacgag
gacaactgcgcgaagacctggaacgaggaccagcaagacaccgaccacgacggcatcggc
gacgtctgcgacaactgcccgcgccagcacaatcccgaccaggccgacgaggacggcgat
cgcgtgggcgacgtctgcgacaacaaccacgaccgggacaaggacggcatccaggacgac
atcgacaactgcaagaacgatccgaatcccagtcagaccgactcggacaacgacggcatc
ggcgacgagtgcgacgaggacgccgacaacgacgaccggctcaaccacgaggacaactgc
ccctacgtgcacaatcccgatcaggcggatctcaatggtgacggaatcggcgacgcttgc
ttcgatgacaacgataacgataaggtcggaaacctcatcgacatctgcccgaacaacagc
cgagtctgggctacagatttccgaaaatacgacaccatcgctcttgacccctacggcaag
acccaagaagatccaatctgggagattcaccataatggctccgaaatttatcagacgatg
aatagcgatcctggaattgccgtcggcttggacagcttcagcggcgtcgatttcgagggt
acgttcttcgtcaacacggatatcgacgacgattacgtgggcttcgtcttctcctatcaa
aacactcggcagttctacacggtcatgtggaaaaaggtgctgcagacatactgggagccg
aaacccttccgggccgtcgctgaaactggcatccaattgaagctcgtcgactccaagacc
ggacccggtgaaatcatgcgcaacagcctctggcatacgggcaacacgcgcgatcaggtg
aaactgctgtggaaggatccgcgaaaggtcggctggaagcagtacacgtcctacaggtgg
cgattgattcacaggccgaggatcggtttgatccgtctctggatctacgaaggccagagg
ctcatcgccgactctggcaataactttgactcgaccctcaaaggcggcagactcggagtc
ttcgctttctcccagcaaatggtgctctggtcgaatctcaagtacacgtgtaaagagacc
gtgccttacgaggtgtatcggacgctgcccccgaacatacagccactcgtccacaccgac
tacaatcgtccgtga

DBGET integrated database retrieval system