KEGG   Nasonia vitripennis (jewel wasp): 100114667Help
Entry
100114667         CDS       T01081                                 

Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100114667
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100114667
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100114667
  Exosomal proteins of colorectal cancer cells
   100114667
  Exosomal proteins of bladder cancer cells
   100114667
Cell adhesion molecules and their ligands [BR:nvi04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100114667
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100114667
   VNR
     100114667
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100114667
Glycosaminoglycan binding proteins [BR:nvi00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100114667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1044 aa AA seqDB search
MRGVATIVLFVALATISSSSLAPDEGLTKTLEKVLMDDKFAITVDHVKSRKKPTNSIETF
FAAESFNAKSKLVAMIDRRSKRIILETVQDNQPRREHIVADSLDISEPFRNLVLIVDQRA
QKVQVYVDCKLQGEIALRRSLKQMAQHAGDLPLEVFRERRYRTRIYGSGEIEQALHREDC
PSTTLYDLEVPEDSRQLHGNQSTRVRRRGDIPGDIPALVDPNGCYTDELMAKTLNQLIDA
IRKMWTKLDLNLLETKRIRELLENCAACQEKPTPPPPPPRSCRYNSPCFPNAECRDTPSG
PQCLRCPSGYYGDGRNCRRYPGCSDGPCFEGVDCMDTATGFTCGPCPRGYTGNGQHCERI
NACQPNPCFPNVPCNPTHVPPYFRCGHCPAGYHGNGVSCSREDECDLAKPCWQGVRCHKY
ESGYRCDPCPEGMSGNSSSGRGVEYALTHKQFCYKIDPCSDNNGGCVENSDCINSEGTAR
CGACKAGFVGDQTVGCHPSHEVCPDGVMRCDRHADCICVAVNQYSCRCNVGWAGDGLICG
VDSDSDGYPDERLNCQDLRCRADNCPKTPNSGQEDADGDGMGNACDEDADNDGVLNLSDN
CPLLANSDQADSDQEGPDDVGDVCDNCPYVKNRDQHDTDGDGIGDACDNDMDNDGVPNNE
DNCAKTWNEDQQDTDHDGIGDVCDNCPRQHNPDQADEDGDRVGDVCDNNHDRDKDGIQDD
IDNCKNDPNPSQTDSDNDGIGDECDEDADNDDRLNHEDNCPYVHNPDQADLNGDGIGDAC
FDDNDNDKVGNLIDICPNNSRVWATDFRKYDTIALDPYGKTQEDPIWEIHHNGSEIYQTM
NSDPGIAVGLDSFSGVDFEGTFFVNTDIDDDYVGFVFSYQNTRQFYTVMWKKVLQTYWEP
KPFRAVAETGIQLKLVDSKTGPGEIMRNSLWHTGNTRDQVKLLWKDPRKVGWKQYTSYRW
RLIHRPRIGLIRLWIYEGQRLIADSGNNFDSTLKGGRLGVFAFSQQMVLWSNLKYTCKET
VPYEVYRTLPPNIQPLVHTDYNRP
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcgtcgctacgatcgtgctcttcgtggcgctcgccactatttctagctcgagc
ctcgcgcccgacgagggtttaaccaaaactctggagaaggtcttgatggacgacaagttc
gccatcaccgtggaccacgtgaaatcccgtaagaagccgaccaactccatcgagacgttc
ttcgccgcggagtccttcaacgccaagtcgaaactcgtcgccatgatcgacaggcgatcg
aagcgaataatcctggagacggtccaggacaaccagccgcgtcgcgaacacatcgtcgcc
gacagtctggacatatccgagcccttcaggaacctcgtccttatcgtggaccagcgagcc
cagaaggtccaggtctacgtcgactgcaagctgcagggcgagatcgcgctgaggaggagc
ctcaaacaaatggctcaacacgccggtgatctgcccctcgaagtgttccgggagcgcaga
tacaggacgaggatttatggaagcggcgagatcgagcaggctctgcaccgcgaggactgc
cccagcacgacgctctacgacctcgaggtgccggaggactcgcgccaactgcacggcaac
cagagcacgagggtcaggaggaggggcgatattcccggcgacattcccgccctcgtcgat
cccaacggctgctacacggacgagctcatggccaagacgctgaatcagctcatcgacgcg
atcaggaagatgtggaccaagctcgatctgaacctgctcgagaccaagcgcatccgggag
ctgctggagaactgcgcggcctgccaggagaaaccgacaccgccaccgccgcctccacga
agctgtcggtacaactcgccgtgcttcccgaacgccgagtgccgtgacacccccagcggt
ccccagtgtctgcgctgtccctctggctattacggcgacgggcgcaattgccgcagatat
cccggctgcagcgacggcccctgcttcgagggcgtcgactgcatggacaccgccaccgga
ttcacctgcggcccgtgtccgcgcggctacaccggcaacgggcagcactgcgagcgcatc
aacgcctgccagccgaatccctgcttcccgaacgtaccctgcaatccgacccacgtgccg
ccgtacttccgatgcggccactgtcctgccggatatcacggcaacggagtcagctgcagc
cgcgaggacgagtgcgatcttgccaagccctgctggcagggagtcaggtgccacaagtac
gagagcggatacagatgcgacccctgccccgaaggcatgagcggcaacagctcctcggga
cgcggcgtcgagtacgccctgacgcacaagcagttctgctacaagatcgacccttgcagc
gacaacaacggcggctgcgtcgagaactcggactgcatcaactccgaggggacagctaga
tgtggcgcgtgcaaagccggttttgtcggcgatcagacggtaggctgccatcccagtcac
gaagtctgtccggatggagtcatgagatgcgaccgacacgccgactgtatctgcgtcgca
gtcaaccagtattcctgcaggtgcaacgtcggctgggccggcgacggtctgatctgcggc
gtagactcggacagcgacggctaccccgacgagcggctcaactgccaagacctgcgttgc
cgagccgacaactgcccgaagacgcccaacagcggccaggaagatgccgacggcgacggc
atgggaaacgcctgcgacgaggacgccgacaacgacggagtgctcaatctgtcggacaac
tgtcctctgctggccaacagcgaccaggcggacagcgaccaagagggtcccgacgacgta
ggggacgtctgcgacaactgtccctacgtgaagaacagagatcagcacgacactgacgga
gacggcatcggcgacgcctgcgacaacgacatggacaacgatggtgtgccgaacaacgag
gacaactgcgcgaagacctggaacgaggaccagcaagacaccgaccacgacggcatcggc
gacgtctgcgacaactgcccgcgccagcacaatcccgaccaggccgacgaggacggcgat
cgcgtgggcgacgtctgcgacaacaaccacgaccgggacaaggacggcatccaggacgac
atcgacaactgcaagaacgatccgaatcccagtcagaccgactcggacaacgacggcatc
ggcgacgagtgcgacgaggacgccgacaacgacgaccggctcaaccacgaggacaactgc
ccctacgtgcacaatcccgatcaggcggatctcaatggtgacggaatcggcgacgcttgc
ttcgatgacaacgataacgataaggtcggaaacctcatcgacatctgcccgaacaacagc
cgagtctgggctacagatttccgaaaatacgacaccatcgctcttgacccctacggcaag
acccaagaagatccaatctgggagattcaccataatggctccgaaatttatcagacgatg
aatagcgatcctggaattgccgtcggcttggacagcttcagcggcgtcgatttcgagggt
acgttcttcgtcaacacggatatcgacgacgattacgtgggcttcgtcttctcctatcaa
aacactcggcagttctacacggtcatgtggaaaaaggtgctgcagacatactgggagccg
aaacccttccgggccgtcgctgaaactggcatccaattgaagctcgtcgactccaagacc
ggacccggtgaaatcatgcgcaacagcctctggcatacgggcaacacgcgcgatcaggtg
aaactgctgtggaaggatccgcgaaaggtcggctggaagcagtacacgtcctacaggtgg
cgattgattcacaggccgaggatcggtttgatccgtctctggatctacgaaggccagagg
ctcatcgccgactctggcaataactttgactcgaccctcaaaggcggcagactcggagtc
ttcgctttctcccagcaaatggtgctctggtcgaatctcaagtacacgtgtaaagagacc
gtgccttacgaggtgtatcggacgctgcccccgaacatacagccactcgtccacaccgac
tacaatcgtccgtga

DBGET integrated database retrieval system