KEGG   Nasonia vitripennis (jewel wasp): 100114717Help
Entry
100114717         CDS       T01081                                 

Definition
clathrin heavy chain-like
Orthology
K04646  
clathrin heavy chain
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100114717
   04142 Lysosome
    100114717
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100114717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 1680 aa AA seqDB search
MTQLLPIRFQEHLQLTAVGINANNVSFNTVTMESDKFICVREKVGDTAQVVIIDMNDSAN
PIRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMAEDVVFWKWISLNTLA
LVTETSVYHWSMEGDSQPSKAFERHSSLQGCQIINYRTDAKQSWLLLIGISAHNNRVVGA
MQLYSVERKCSQPIEGHAASFAQFKMEGNAEPSNLFCFAVRTVQGAKLHIIEVGTPPVKN
QPFPKKAVDVFFPPEAGNDFPVAMQVSSKYDVIYLITKYGYIHMYDIESATCIFMNRISG
ETIFVTASHESSGGIIGVNRKGQVLSVSVDEENIIPYINGVLQNPELALRMAVRNNLSGA
EDLFVRKFNMLFQNGQYAEAAKVAANAPKGILRTPGTIQKFQQVPTTQGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLVQGRKQLLEKWLKEDKLECSEELGDLVKQVDPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVSYTPDYIFLLRNVMRINPDQGVLFAQMLVQDD
EPLADINQIVDIFMEQNMVQQCTAFLLDALKNNRPSEGALQTRLLEMNLMSAPQVADAIL
GNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLSPDWLVGFFGTLSV
EDSLECLKAMLTANMRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIVN
FSQDQEVHFKYIQAACKTGQIKEVERICRESNCYSPERVKNFLKEAKLSDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDIIKNLILVVRGQF
STDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQFY
DSRVVGKYCEKRDPHLACIAYERGQCDRELISVCNENSLFKSEARYLVRRRDPDLWAEVL
QESNPYKRPLIDQVVQTALSETQDPEDISVTVRAFMTADLPNELIELLEKIVLDSSVFSD
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAINNELYEEAFAIFKKFDVNTS
AIQVLIEQVNNLDRAYEFAERCNEPAVWSQLARAQLQQGMVKEAIDSFIKADDPSAYVDV
VETAHRTSHWEDLVRYLQMARKKARESFIESELIYAYARTNRLADLEEFISGPNHADIQK
IGDRCFDDKMYDAAKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFAC
VDSGEFRLAQMCGLHIVVHADELEDLINYYQDRGHFEELINLLEAALGLERAHMGMFTEL
AILYSKYKPQRMREHLELFWSRVNIPKVLRAAESAHLWAELVFLYDKYEEYDNAVLAMMQ
HPTEAWREGHFKDVITKVANVELYYKAIQFYVEYKPLLLNDILLVLAPRMDHTRSVAYFT
RTNHLQLVKPYLRSVQALNNKAINEALNGLLIDEEDYQGLRTSIDAFDNFDNIALAQQLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDRLFRDAMEYAAESRNHEVAEELLEWFLER
GSKDCFAACLFHCYDLLHPDVILELAWRHQIMHFAMPYLIQVSREYITKVDKLEEAESRR
IEETDHQEHKSMIMPEPQLMLTAGPGMIAPGYAPAGVYAPPAQGVYGAPPAAAAYQTYGM
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctactgcccataaggttccaggagcatctccagctcaccgcagtggggatc
aatgccaacaatgtcagcttcaacacagtcaccatggagtcggacaagttcatctgtgtc
cgtgaaaaggtgggtgacaccgcacaggtggttatcatcgacatgaatgactccgccaac
cccatcaggaggcccatatctgcagattcagccatcatgaatcctgccagcaaagtcatt
gctctcaaagcgcaaaagaccctgcagatcttcaacatcgagatgaagtcaaagatgaag
gcgcacacgatggcggaggacgtcgtattctggaagtggatctccctaaataccctggct
ctcgtgactgaaacctcggtttatcattggtcgatggaaggtgattcccagccaagcaaa
gcttttgagcgtcactcttcgctccaaggttgccagatcatcaattaccgcaccgatgcc
aagcaatcctggctccttctgatcggtatctcggcgcacaacaaccgtgtcgtcggcgcc
atgcaactctactcggtcgagcgcaagtgctcccagccgatcgagggtcatgctgcctcg
tttgcccagttcaagatggagggcaatgccgagcccagcaatttgttctgcttcgccgtc
aggaccgtccagggtgccaagctgcacatcatcgaagttggcacgccaccggtcaagaac
cagcccttccccaagaaggcagtcgacgtatttttcccgcccgaggccggcaacgatttt
ccggtcgctatgcaggtgagctcaaagtacgacgtgatctacctgatcaccaaatacggc
tacatccacatgtacgacattgaatcagcgacatgcatctttatgaaccgcatttctggc
gagacgattttcgtgaccgcatcccacgagtcatcgggtggtataattggagtgaaccgc
aagggtcaggtgctctcggtctccgtagacgaagaaaacatcataccttacatcaacggt
gtactgcaaaatccagagctagcgttgcgcatggctgtacgtaacaacctctccggcgcc
gaggacctcttcgtgcgcaagttcaatatgctcttccagaatggacagtacgctgaggct
gctaaagtcgccgcaaatgcgcccaaaggtatcctacgtactcctggaacaatccagaag
ttccagcaggtgccgacgacacagggtcaaacatcgcctcttctccaatacttcggtatc
cttctcgaccagggtcagctgaacaaatacgagtcacttgaattgtgccgtccggtactc
gtacagggccgcaagcagctgcttgagaaatggctgaaggaggacaagcttgagtgcagt
gaagagctgggcgaccttgtcaagcaggtcgatccaaccctcgcactgagcgtctacctc
agagccaacgttcccaacaaagtgatacagtgcttcgccgagaccggtcagttccagaag
atcgtgctctatgcgaagaaggtttcctacacgcctgactacatattcttgctgcgcaac
gtcatgagaatcaatccggatcagggtgtgctgttcgcacagatgctcgtccaggacgat
gagccactcgctgatattaatcaaattgtcgatatctttatggaacagaacatggtacag
cagtgcacggcgttcttgctcgatgctctcaaaaacaacagacccagtgaaggagctctc
caaacaagattgctcgagatgaacctcatgtccgctcctcaggtggctgatgcgatcctt
ggtaaccaaatgttcacgcactacgatcgtgcgcacgtcgcccagctctgtgagaaggcc
ggtcttctgcaacgtgctcttgagcactacaccgatctctacgacatcaaacgtgccgtg
gtccacacacacctgctgtctccggattggctggttggtttcttcggtacgctgtctgtc
gaagactcgcttgagtgtctcaaggctatgctcaccgccaacatgcgccagaatcttcaa
atttgcgtgcagatcgctactaaataccatgaacagctcactaccaaggcccttatcgac
cttttcgagagctttaaatcctacgagggtctcttttacttccttggttccattgtcaac
ttcagtcaagaccaggaagtacacttcaagtacatccaagctgcctgcaagactggccag
attaaggaggtcgaacgcatctgtcgcgaaagcaactgttacagcccagagcgcgtcaag
aactttttgaaggaagctaagttgtctgaccagttaccgctgatcattgtctgcgatcga
tttgattttgttcacgatctcgtactttacctctaccgcaacaatcttcagaagtacatc
gagatctacgtgcaaaaggtcaacccatcgcgtttacctgtcgttatcggtggtctgctt
gatgtcgattgctccgaagacatcatcaagaacctgatcctcgtagtgcgtggacagttc
tctaccgacgagctcgtagaagaagtcgagaagcgcaaccgcttgaagcttttacttccc
tggttagagtctcgagtccatgaaggatgcgttgagccagccacccataacgccctcgcc
aagatctacatcgacagcaataacaatcctgagcgtttccttaaagaaaaccaattctac
gatagccgtgtcgttggaaagtactgcgaaaagcgcgacccgcatctagcttgcatcgct
tatgaacgtggacagtgcgaccgtgagcttatcagcgtttgcaatgagaacagcttgttc
aagagcgaagccagatacttggtgcgcagacgtgaccccgacctctgggctgaagtactc
caggagagcaacccctataagaggccactgatcgatcaagttgtgcagaccgctctgtcg
gagactcaagatcctgaggatatctccgtgactgtgagagcctttatgacggccgatctg
ccgaatgagcttatcgagctgctggaaaagatcgtactcgacagcagcgtctttagtgac
catcgcaacttacagaatctcttgattttgacggctatcaaggctgataggaccagggtt
atggaatacattaatcgtctcgataattacgatgctcctgacattgctaacatcgctatc
aacaacgagctgtatgaggaagcattcgccatcttcaagaaattcgacgtcaacacctcg
gccatccaggtgctgatcgagcaggtcaacaacttagacagagcttacgagtttgctgaa
agatgcaacgagcctgccgtctggtctcaacttgcccgcgctcagctgcagcaaggtatg
gtgaaggaggcgatcgacagcttcatcaaggctgatgacccctctgcctacgtcgatgtc
gtcgagacagctcatcgcacctctcactgggaagatctagtgcgctatttgcagatggcc
cgcaagaaggcgcgtgaatcctttatcgaatctgagctcatctatgcttacgcccggaca
aaccgcctggccgatcttgaggaatttatttctggtccgaaccatgccgacatacagaag
attggagaccgctgcttcgacgacaagatgtacgatgctgcaaagcttctctacaacaac
gtttcgaactttgctagattggccatcaccctggtgcacttaaaggaattccagggagcg
gtggacagcgcgcgcaaagccaactcgacgcgcacctggaaggaggtctgcttcgcttgc
gtcgacagcggcgagttcaggctcgctcagatgtgtggtctccacattgtcgtgcacgct
gatgaattggaggatctcattaactattatcaagataggggacactttgaagagcttatc
aatctgctggaggctgctcttggtctcgagagggctcacatgggaatgttcactgaactg
gctattctgtacagcaagtacaagccacagagaatgagggaacatctggaactcttctgg
tctcgcgttaatattccaaaggtactgcgcgctgcagagtccgctcacctgtgggccgag
ctggtcttcttgtacgacaagtacgaggaatacgataacgcggtgcttgcaatgatgcaa
catccaacagaagcatggcgtgaaggtcacttcaaagacgttatcacaaaggtcgcgaac
gtagagctctactacaaggcaattcagttctatgtagagtacaagccactactgctcaat
gacatcttgctggttctggcaccgcgcatggaccacactaggtctgttgcctacttcact
cgcaccaaccacttgcagctggttaagccctacctgagatcagtacaagcactaaacaac
aaggcaatcaacgaggctctaaatggtttactgatcgacgaggaggactaccagggtctt
aggacctcgattgatgccttcgacaacttcgacaacattgcgctggcgcaacagttggag
aagcacgaactcatcgagttcaggagaatcgccgcctacctgtacaagggtaacaacagg
tggaagcagtccgtcgagctgtgtaaaaaggataggcttttcagagatgcaatggagtac
gcagctgaatctcgcaaccacgaagtagccgaagaattgttagaatggttccttgaaaga
gggtccaaggactgttttgcggcttgtctgttccactgctatgatttgcttcatccagac
gttattttggagctcgcgtggagacaccaaatcatgcacttcgcaatgccttatcttatt
caagtatctcgcgaatatattacaaaggtcgacaaattagaggaagctgaaagtcgtcgc
atcgaggagactgatcaccaagaacacaaatccatgatcatgcccgagccccagctgatg
ttgacagccggacccggcatgattgcaccgggctacgcgcctgcaggtgtctacgctcca
ccggcacaaggcgtctatggagcaccacctgctgccgcggcttatcagacgtatggtatg
tga

DBGET integrated database retrieval system